BLASTX nr result
ID: Cinnamomum23_contig00003658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00003658 (212 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010921579.1| PREDICTED: UPF0481 protein At3g47200-like [E... 59 2e-06 >ref|XP_010921579.1| PREDICTED: UPF0481 protein At3g47200-like [Elaeis guineensis] Length = 470 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/74 (37%), Positives = 46/74 (62%), Gaps = 7/74 (9%) Frame = -1 Query: 203 WMLPAIIHDMLLLENQIPFSILKRLFELIETSNRESKTCFKGLALDFLRR-------PLF 45 WM P I HD+L+LENQIPF ILK +F+++++S++E++ LAL+++ P Sbjct: 164 WMSPLIRHDLLILENQIPFIILKAIFDVVQSSSQENRPSLMVLALNYITHGKETEIPPKM 223 Query: 44 WKLKTPHSKDIHHL 3 + + H +HHL Sbjct: 224 YDHEPHHLLHLHHL 237