BLASTX nr result
ID: Cinnamomum23_contig00003119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00003119 (778 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN09506.1| hypothetical protein glysoja_016605 [Glycine soja] 59 3e-06 ref|XP_009403400.1| PREDICTED: uncharacterized protein LOC103986... 59 3e-06 ref|XP_007162753.1| hypothetical protein PHAVU_001G177600g [Phas... 57 1e-05 >gb|KHN09506.1| hypothetical protein glysoja_016605 [Glycine soja] Length = 50 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 484 MGFVLVISLPLILFVIILALGCYLLGRAKGRQE 386 MGFV+VISLPLILF++ILAL CYLLGRAKGR++ Sbjct: 1 MGFVVVISLPLILFILILALACYLLGRAKGRRQ 33 >ref|XP_009403400.1| PREDICTED: uncharacterized protein LOC103986965 [Musa acuminata subsp. malaccensis] Length = 69 Score = 58.9 bits (141), Expect = 3e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 484 MGFVLVISLPLILFVIILALGCYLLGRAKGRQEA 383 MGFV+VISLPLILF ++L GC+LLGRAKGR+EA Sbjct: 1 MGFVMVISLPLILFTVLLGFGCFLLGRAKGREEA 34 >ref|XP_007162753.1| hypothetical protein PHAVU_001G177600g [Phaseolus vulgaris] gi|561036217|gb|ESW34747.1| hypothetical protein PHAVU_001G177600g [Phaseolus vulgaris] Length = 50 Score = 57.4 bits (137), Expect = 1e-05 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 484 MGFVLVISLPLILFVIILALGCYLLGRAKGRQE 386 MGFV+VISLPLILF++ILAL CY+LGRAKGR++ Sbjct: 1 MGFVVVISLPLILFILILALVCYMLGRAKGRRQ 33