BLASTX nr result
ID: Cinnamomum23_contig00002952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00002952 (291 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KGN65718.1| hypothetical protein Csa_1G515470 [Cucumis sativus] 57 4e-06 ref|XP_009588682.1| PREDICTED: outer envelope pore protein 16, c... 57 4e-06 ref|XP_008457483.1| PREDICTED: outer envelope pore protein 16, c... 57 4e-06 ref|XP_006361206.1| PREDICTED: outer envelope pore protein 16, c... 57 4e-06 ref|XP_011658142.1| PREDICTED: outer envelope pore protein 16, c... 57 4e-06 >gb|KGN65718.1| hypothetical protein Csa_1G515470 [Cucumis sativus] Length = 118 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -2 Query: 290 NALIGGAITGALISAASNNNKDKVMVDXXXXXXXXXXAKFLNYLT 156 NA+IGGA+TGAL+SAASNNN+DKV++D A+F+NYLT Sbjct: 74 NAMIGGALTGALVSAASNNNRDKVVIDAITGGAVATAAEFINYLT 118 >ref|XP_009588682.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Nicotiana tomentosiformis] Length = 146 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 290 NALIGGAITGALISAASNNNKDKVMVDXXXXXXXXXXAKFLNYLT 156 NA+IGGA+TGALISAASNNN+DK+++D A+FLNYLT Sbjct: 102 NAMIGGALTGALISAASNNNRDKIVMDAITGGAVATAAEFLNYLT 146 >ref|XP_008457483.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Cucumis melo] Length = 146 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -2 Query: 290 NALIGGAITGALISAASNNNKDKVMVDXXXXXXXXXXAKFLNYLT 156 NA+IGGA+TGAL+SAASNNN+DKV++D A+F+NYLT Sbjct: 102 NAMIGGALTGALVSAASNNNRDKVVIDAITGGAVATAAEFINYLT 146 >ref|XP_006361206.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 122 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -2 Query: 290 NALIGGAITGALISAASNNNKDKVMVDXXXXXXXXXXAKFLNYLT 156 NA+IGGA+TGALISAASNNN+DK+++D ++FLNYLT Sbjct: 78 NAMIGGALTGALISAASNNNRDKIVMDAITGGAVATASEFLNYLT 122 >ref|XP_011658142.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Cucumis sativus] Length = 146 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -2 Query: 290 NALIGGAITGALISAASNNNKDKVMVDXXXXXXXXXXAKFLNYLT 156 NA+IGGA+TGAL+SAASNNN+DKV++D A+F+NYLT Sbjct: 102 NAMIGGALTGALVSAASNNNRDKVVIDAITGGAVATAAEFINYLT 146