BLASTX nr result
ID: Cinnamomum23_contig00002324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00002324 (1492 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIG89988.1| hypothetical protein (mitochondrion) [Capsicum an... 80 3e-12 gb|EPS74520.1| hypothetical protein M569_00237 [Genlisea aurea] 67 5e-08 gb|KMS94616.1| hypothetical protein BVRB_016980 [Beta vulgaris s... 59 1e-05 >gb|AIG89988.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 115 Score = 80.5 bits (197), Expect = 3e-12 Identities = 56/111 (50%), Positives = 63/111 (56%), Gaps = 4/111 (3%) Frame = -1 Query: 1240 KKKMKGRLIQNPVMTSLLSNFTLHNALFL*NIYIYIER----EREALSRLLNLRNC*GEK 1073 K+K KGR IQNP + + LH + ER E ALS LLN + K Sbjct: 10 KEKSKGRFIQNPNCD--IPSLPLHTS----------ERTLLIEINALSHLLNPKWLGRGK 57 Query: 1072 RFLF*GTIGNRSSGDGMGHVA*RFRASG*EQRCQEFESLLAHNRPKRRGPF 920 F GT GNRSSGDG+G VA R RA G E RC+ FESLLAHNRPKR PF Sbjct: 58 VPFFEGTPGNRSSGDGVGPVAQRIRARGYEPRCRGFESLLAHNRPKREVPF 108 >gb|EPS74520.1| hypothetical protein M569_00237 [Genlisea aurea] Length = 173 Score = 66.6 bits (161), Expect = 5e-08 Identities = 34/54 (62%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = +2 Query: 917 KERSSPFGPVVGEEGFELLTPLFLATCSKPLSYMPHPISTRS-VPYSTLKKEPF 1075 +ER PFGPVVGEEGFE TP F+AT S PLSY PHP+ST S +PYS + F Sbjct: 4 RERYFPFGPVVGEEGFEPPTPWFVATRSNPLSYRPHPVSTGSDLPYSIVTAVEF 57 >gb|KMS94616.1| hypothetical protein BVRB_016980 [Beta vulgaris subsp. vulgaris] Length = 50 Score = 58.9 bits (141), Expect = 1e-05 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = -1 Query: 1072 RFLF*GTIGNRSSGDGMGHVA*RFRASG*EQRCQEFESLLAHNRPKR 932 R F T GNRSSG G+G VA R RA G E RC+ FESLLAHNRP+R Sbjct: 3 RSYFEDTPGNRSSGGGVGPVAQRIRARGYEPRCRGFESLLAHNRPQR 49