BLASTX nr result
ID: Cimicifuga21_contig00041390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00041390 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADP20179.1| gag-pol polyprotein [Silene latifolia] 40 3e-07 ref|XP_002527588.1| hypothetical protein RCOM_1568080 [Ricinus c... 44 8e-07 >gb|ADP20179.1| gag-pol polyprotein [Silene latifolia] Length = 1475 Score = 40.0 bits (92), Expect(2) = 3e-07 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 5/65 (7%) Frame = +3 Query: 150 FEYKALS-GSKYGSLVATNYWYAEIWWD----ERQLVGHEPIRS*RDMKEALEKEFIPKT 314 FE+K S G + + YA +W++ +R+ G EPI+S +K+ L ++FIPK Sbjct: 115 FEFKGYSDGKAFKVAILKLKGYASLWYENLKNQRRRDGKEPIKSWLKLKKKLNEKFIPKE 174 Query: 315 YKRDL 329 Y +D+ Sbjct: 175 YTQDI 179 Score = 38.9 bits (89), Expect(2) = 3e-07 Identities = 11/36 (30%), Positives = 25/36 (69%) Frame = +1 Query: 67 DIKIDVPEFNGKMDPDTFVDWLNKIKKILSTKHFLD 174 D+K+++P+F+G ++P+ +DW I+++ K + D Sbjct: 87 DLKVEIPDFHGSLNPEDLLDWFRTIERVFEFKGYSD 122 >ref|XP_002527588.1| hypothetical protein RCOM_1568080 [Ricinus communis] gi|223533034|gb|EEF34796.1| hypothetical protein RCOM_1568080 [Ricinus communis] Length = 136 Score = 43.5 bits (101), Expect(2) = 8e-07 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 5/68 (7%) Frame = +3 Query: 150 FEYKALSGSKYGSLVATNYW-YAEIWWD----ERQLVGHEPIRS*RDMKEALEKEFIPKT 314 FE S K L A + YA +WWD ER+ G P+ S +MK+ + K FIP Sbjct: 43 FECHNYSEEKKVKLAAVEFSDYAIVWWDQFCKERRRYGERPVESWIEMKQIMRKRFIPSH 102 Query: 315 YKRDLLDR 338 Y R+L R Sbjct: 103 YYRELHQR 110 Score = 34.3 bits (77), Expect(2) = 8e-07 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 70 IKIDVPEFNGKMDPDTFVDWLNKIKKILSTKHF 168 IK+ +P F G+ DPD +++W K++ I ++ Sbjct: 16 IKMKIPSFQGRNDPDVYLEWERKVELIFECHNY 48