BLASTX nr result
ID: Cimicifuga21_contig00041382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00041382 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263197.2| PREDICTED: putative pentatricopeptide repeat... 124 8e-27 ref|XP_002512645.1| pentatricopeptide repeat-containing protein,... 120 1e-25 ref|XP_002304652.1| predicted protein [Populus trichocarpa] gi|2... 117 7e-25 ref|XP_003529187.1| PREDICTED: putative pentatricopeptide repeat... 116 2e-24 ref|XP_004152153.1| PREDICTED: putative pentatricopeptide repeat... 110 2e-22 >ref|XP_002263197.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Vitis vinifera] Length = 611 Score = 124 bits (311), Expect = 8e-27 Identities = 53/81 (65%), Positives = 74/81 (91%) Frame = +3 Query: 3 RLIFDTMSELDDVSWNSMISGYSLHGLGGDALKLFETMRKTEVKPNKITFVGILSACSNT 182 RL+FD M++ D+VSWN+MISGYS+HGLG +AL++F+ M++TEVKP+K+TFVG+LSAC+N Sbjct: 294 RLVFDLMNKQDEVSWNAMISGYSMHGLGREALRIFDKMQETEVKPDKLTFVGVLSACANA 353 Query: 183 GLVEQGRSYFDSMYQDYGIEP 245 GL++QG++YF SM QD+GIEP Sbjct: 354 GLLDQGQAYFTSMIQDHGIEP 374 >ref|XP_002512645.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548606|gb|EEF50097.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 716 Score = 120 bits (301), Expect = 1e-25 Identities = 54/81 (66%), Positives = 69/81 (85%) Frame = +3 Query: 3 RLIFDTMSELDDVSWNSMISGYSLHGLGGDALKLFETMRKTEVKPNKITFVGILSACSNT 182 RL+FD +SE D++SWN+MISGYS+HGL G+ALK F+ M++TE PNK+TFV ILSACSN Sbjct: 399 RLVFDMLSERDEISWNAMISGYSMHGLVGEALKAFQMMQETECVPNKLTFVSILSACSNA 458 Query: 183 GLVEQGRSYFDSMYQDYGIEP 245 GL++ G++YF SM QDYGIEP Sbjct: 459 GLLDIGQNYFKSMVQDYGIEP 479 >ref|XP_002304652.1| predicted protein [Populus trichocarpa] gi|222842084|gb|EEE79631.1| predicted protein [Populus trichocarpa] Length = 820 Score = 117 bits (294), Expect = 7e-25 Identities = 53/81 (65%), Positives = 69/81 (85%) Frame = +3 Query: 3 RLIFDTMSELDDVSWNSMISGYSLHGLGGDALKLFETMRKTEVKPNKITFVGILSACSNT 182 RL+FD + E D VSWN+MISGYS+HGL G+ALK FE+M +TE KP+K+TFVGILSACSN Sbjct: 503 RLVFDMLREHDQVSWNAMISGYSVHGLYGEALKTFESMLETECKPDKVTFVGILSACSNA 562 Query: 183 GLVEQGRSYFDSMYQDYGIEP 245 GL+++G++YF SM ++Y IEP Sbjct: 563 GLLDRGQAYFKSMVEEYDIEP 583 >ref|XP_003529187.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Glycine max] Length = 780 Score = 116 bits (290), Expect = 2e-24 Identities = 51/81 (62%), Positives = 68/81 (83%) Frame = +3 Query: 3 RLIFDTMSELDDVSWNSMISGYSLHGLGGDALKLFETMRKTEVKPNKITFVGILSACSNT 182 RL FD M + D+VSWN++I GYS+HGLG +AL LF+ M+++ KPNK+TFVG+LSACSN Sbjct: 463 RLTFDKMDKQDEVSWNALICGYSIHGLGMEALNLFDMMQQSNSKPNKLTFVGVLSACSNA 522 Query: 183 GLVEQGRSYFDSMYQDYGIEP 245 GL+++GR++F SM QDYGIEP Sbjct: 523 GLLDKGRAHFKSMLQDYGIEP 543 >ref|XP_004152153.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Cucumis sativus] gi|449515059|ref|XP_004164567.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Cucumis sativus] Length = 721 Score = 110 bits (274), Expect = 2e-22 Identities = 47/81 (58%), Positives = 66/81 (81%) Frame = +3 Query: 3 RLIFDTMSELDDVSWNSMISGYSLHGLGGDALKLFETMRKTEVKPNKITFVGILSACSNT 182 R +FD + D VSWN++I GYS+HGLG +A+K+F M++T+ KP+++TFVG+LSACSNT Sbjct: 404 RFMFDMLDLRDKVSWNAIICGYSMHGLGVEAIKMFNLMKETKCKPDELTFVGVLSACSNT 463 Query: 183 GLVEQGRSYFDSMYQDYGIEP 245 G +++G+ YF SM QDYGIEP Sbjct: 464 GRLDEGKQYFTSMKQDYGIEP 484