BLASTX nr result
ID: Cimicifuga21_contig00041197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00041197 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135836.1| PREDICTED: geranylgeranyl transferase type-2... 65 2e-10 ref|XP_002740225.1| PREDICTED: RAB geranylgeranyltransferase, be... 66 3e-09 ref|XP_002528097.1| geranylgeranyl transferase type II beta subu... 66 3e-09 ref|XP_002533679.1| geranylgeranyl transferase type II beta subu... 66 3e-09 ref|XP_002319501.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 >ref|XP_004135836.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Cucumis sativus] gi|449490992|ref|XP_004158768.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Cucumis sativus] Length = 317 Score = 65.5 bits (158), Expect(2) = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 222 LHHIHKDLLGWWLCERQVQSGGLNELPEKLPD 317 LHH+ KDLLGWWLCERQV+SGGLN PEKLPD Sbjct: 193 LHHVDKDLLGWWLCERQVKSGGLNGRPEKLPD 224 Score = 24.3 bits (51), Expect(2) = 2e-10 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 187 VFCCVCTLALTG 222 +FCCV LALTG Sbjct: 180 IFCCVGALALTG 191 >ref|XP_002740225.1| PREDICTED: RAB geranylgeranyltransferase, beta subunit-like [Saccoglossus kowalevskii] Length = 358 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = +3 Query: 177 HANSFLLC--MYPCFNRLHHIHKDLLGWWLCERQVQSGGLNELPEKLPD 317 H+ C M RLHHI+ DLLGWWLCERQ+ SGGLN PEKLPD Sbjct: 215 HSGQIYCCVGMLSIIGRLHHINADLLGWWLCERQLPSGGLNGRPEKLPD 263 >ref|XP_002528097.1| geranylgeranyl transferase type II beta subunit, putative [Ricinus communis] gi|223532486|gb|EEF34276.1| geranylgeranyl transferase type II beta subunit, putative [Ricinus communis] Length = 306 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = +3 Query: 177 HANSFLLCM--YPCFNRLHHIHKDLLGWWLCERQVQSGGLNELPEKLPD 317 HA C+ LHH+ KDLLGWWLCERQV+SGGLN PEKLPD Sbjct: 176 HAGQIFCCVGALAITGSLHHVDKDLLGWWLCERQVKSGGLNGRPEKLPD 224 >ref|XP_002533679.1| geranylgeranyl transferase type II beta subunit, putative [Ricinus communis] gi|223526430|gb|EEF28709.1| geranylgeranyl transferase type II beta subunit, putative [Ricinus communis] Length = 280 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = +3 Query: 177 HANSFLLCM--YPCFNRLHHIHKDLLGWWLCERQVQSGGLNELPEKLPD 317 HA C+ LHH+ KDLLGWWLCERQV+SGGLN PEKLPD Sbjct: 137 HAGQIFCCVGALAITGSLHHVDKDLLGWWLCERQVKSGGLNGRPEKLPD 185 >ref|XP_002319501.1| predicted protein [Populus trichocarpa] gi|222857877|gb|EEE95424.1| predicted protein [Populus trichocarpa] Length = 313 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = +3 Query: 177 HANSFLLCM--YPCFNRLHHIHKDLLGWWLCERQVQSGGLNELPEKLPD 317 HA C+ LHH+ KDLLGWWLCERQV+SGGLN PEKLPD Sbjct: 176 HAGQIFCCVGALAITGSLHHVDKDLLGWWLCERQVKSGGLNGRPEKLPD 224