BLASTX nr result
ID: Cimicifuga21_contig00040979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00040979 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518411.1| Alternative oxidase 4, chloroplast precursor... 55 6e-06 ref|XP_002331574.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 ref|XP_002317190.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002518411.1| Alternative oxidase 4, chloroplast precursor, putative [Ricinus communis] gi|223542256|gb|EEF43798.1| Alternative oxidase 4, chloroplast precursor, putative [Ricinus communis] Length = 356 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 3 KYYTEGDLYLFDEFQTDRVPHSQRPVIGKMKMTRLN 110 KYYTEGDLYLFDEFQT R PHS+RP I + LN Sbjct: 253 KYYTEGDLYLFDEFQTSRAPHSRRPKIDNLYDVFLN 288 >ref|XP_002331574.1| predicted protein [Populus trichocarpa] gi|222873798|gb|EEF10929.1| predicted protein [Populus trichocarpa] Length = 362 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 3 KYYTEGDLYLFDEFQTDRVPHSQRPVIGKMKMTRLN 110 KYYTEGDLYLFDEFQT R PHS+RP I + LN Sbjct: 260 KYYTEGDLYLFDEFQTSRAPHSRRPKIENLYDVFLN 295 >ref|XP_002317190.1| predicted protein [Populus trichocarpa] gi|222860255|gb|EEE97802.1| predicted protein [Populus trichocarpa] Length = 358 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 3 KYYTEGDLYLFDEFQTDRVPHSQRPVIGKMKMTRLN 110 KYYTEGDLYLFDEFQT R PHS+RP I + LN Sbjct: 258 KYYTEGDLYLFDEFQTSRAPHSRRPKIENLYDVFLN 293