BLASTX nr result
ID: Cimicifuga21_contig00040721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00040721 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265761.1| PREDICTED: uncharacterized membrane protein ... 80 2e-13 emb|CBI17878.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_003549270.1| PREDICTED: uncharacterized membrane protein ... 67 1e-09 ref|XP_003595115.1| Solute carrier family 35 member E3 [Medicago... 66 3e-09 ref|XP_002527697.1| organic anion transporter, putative [Ricinus... 66 3e-09 >ref|XP_002265761.1| PREDICTED: uncharacterized membrane protein At1g06890 [Vitis vinifera] Length = 388 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +3 Query: 186 MLCSRDMLNFLIKKDVRKILKRKDSDAGEKGKALEDLRASLYN 314 MLCSR MLNFLI+KDVRKILKRKDSDAGEKGKA+E+LRASL+N Sbjct: 1 MLCSRKMLNFLIRKDVRKILKRKDSDAGEKGKAMEELRASLFN 43 >emb|CBI17878.3| unnamed protein product [Vitis vinifera] Length = 382 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 204 MLNFLIKKDVRKILKRKDSDAGEKGKALEDLRASLYN 314 MLNFLI+KDVRKILKRKDSDAGEKGKA+E+LRASL+N Sbjct: 1 MLNFLIRKDVRKILKRKDSDAGEKGKAMEELRASLFN 37 >ref|XP_003549270.1| PREDICTED: uncharacterized membrane protein At1g06890-like [Glycine max] Length = 378 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 204 MLNFLIKKDVRKILKRKDSDAGEKGKALEDLRASLYN 314 M NFL++KDVRKILKRKDSDAGEKG+ALEDLR SL+N Sbjct: 1 MFNFLLRKDVRKILKRKDSDAGEKGRALEDLRGSLFN 37 >ref|XP_003595115.1| Solute carrier family 35 member E3 [Medicago truncatula] gi|355484163|gb|AES65366.1| Solute carrier family 35 member E3 [Medicago truncatula] Length = 395 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 204 MLNFLIKKDVRKILKRKDSDAGEKGKALEDLRASLYN 314 M NFLI KD RKILKRKDSDAGEKG+ALEDLRASL+N Sbjct: 1 MFNFLIGKDARKILKRKDSDAGEKGRALEDLRASLFN 37 >ref|XP_002527697.1| organic anion transporter, putative [Ricinus communis] gi|223532928|gb|EEF34696.1| organic anion transporter, putative [Ricinus communis] Length = 385 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/43 (69%), Positives = 40/43 (93%) Frame = +3 Query: 186 MLCSRDMLNFLIKKDVRKILKRKDSDAGEKGKALEDLRASLYN 314 ML S ++LNFL++KDV KILKRKDSDAGE+G+ALE++R+SL+N Sbjct: 1 MLFSHEILNFLVRKDVGKILKRKDSDAGERGRALEEVRSSLFN 43