BLASTX nr result
ID: Cimicifuga21_contig00040624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00040624 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281382.2| PREDICTED: zinc finger Ran-binding domain-co... 107 3e-30 emb|CBI15155.3| unnamed protein product [Vitis vinifera] 107 1e-29 ref|XP_003528212.1| PREDICTED: zinc finger Ran-binding domain-co... 105 3e-26 ref|XP_004155056.1| PREDICTED: LOW QUALITY PROTEIN: DNA annealin... 103 6e-26 ref|XP_002514699.1| ATP binding protein, putative [Ricinus commu... 104 6e-26 >ref|XP_002281382.2| PREDICTED: zinc finger Ran-binding domain-containing protein 3-like [Vitis vinifera] Length = 1280 Score = 107 bits (266), Expect(2) = 3e-30 Identities = 52/68 (76%), Positives = 61/68 (89%) Frame = -1 Query: 282 VVVISYTMLHRLRKSMLAQEWALMIVDESHHVRCTQKASESEEIKAILDVTTKVKRKVLL 103 VVVISYTMLHRLRKSML +EW L+IVDESHH++CT+K SE ++IKA+LDV KV+R VLL Sbjct: 297 VVVISYTMLHRLRKSMLEREWPLLIVDESHHLQCTKKKSEPQKIKAVLDVAMKVRRIVLL 356 Query: 102 SGTPSLSR 79 SGTPSLSR Sbjct: 357 SGTPSLSR 364 Score = 49.7 bits (117), Expect(2) = 3e-30 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -2 Query: 71 RPYDIFHQIDMLWPGLLGTNKYE 3 RPYDIFHQI+MLWPGLLG +KYE Sbjct: 364 RPYDIFHQINMLWPGLLGRDKYE 386 >emb|CBI15155.3| unnamed protein product [Vitis vinifera] Length = 1201 Score = 107 bits (266), Expect(2) = 1e-29 Identities = 52/68 (76%), Positives = 61/68 (89%) Frame = -1 Query: 282 VVVISYTMLHRLRKSMLAQEWALMIVDESHHVRCTQKASESEEIKAILDVTTKVKRKVLL 103 VVVISYTMLHRLRKSML +EW L+IVDESHH++CT+K SE ++IKA+LDV KV+R VLL Sbjct: 298 VVVISYTMLHRLRKSMLEREWPLLIVDESHHLQCTKKKSEPQKIKAVLDVAMKVRRIVLL 357 Query: 102 SGTPSLSR 79 SGTPSLSR Sbjct: 358 SGTPSLSR 365 Score = 47.8 bits (112), Expect(2) = 1e-29 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 68 PYDIFHQIDMLWPGLLGTNKYE 3 PYDIFHQI+MLWPGLLG +KYE Sbjct: 367 PYDIFHQINMLWPGLLGRDKYE 388 >ref|XP_003528212.1| PREDICTED: zinc finger Ran-binding domain-containing protein 3-like [Glycine max] Length = 1193 Score = 105 bits (263), Expect(2) = 3e-26 Identities = 53/68 (77%), Positives = 62/68 (91%) Frame = -1 Query: 282 VVVISYTMLHRLRKSMLAQEWALMIVDESHHVRCTQKASESEEIKAILDVTTKVKRKVLL 103 VVVISYTMLHRLRKSML +EWAL+I+DESHHVRCT+K +E EI+A+LDV +KVKR +LL Sbjct: 297 VVVISYTMLHRLRKSMLEREWALLIIDESHHVRCTKK-TEPGEIQAVLDVASKVKRIILL 355 Query: 102 SGTPSLSR 79 SGTPSLSR Sbjct: 356 SGTPSLSR 363 Score = 37.4 bits (85), Expect(2) = 3e-26 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 71 RPYDIFHQIDMLWPGLLGTNKYE 3 RPYDI+HQI+M PGLLG KYE Sbjct: 363 RPYDIYHQINM--PGLLGKTKYE 383 >ref|XP_004155056.1| PREDICTED: LOW QUALITY PROTEIN: DNA annealing helicase and endonuclease ZRANB3-like [Cucumis sativus] Length = 1241 Score = 103 bits (258), Expect(2) = 6e-26 Identities = 49/68 (72%), Positives = 60/68 (88%) Frame = -1 Query: 282 VVVISYTMLHRLRKSMLAQEWALMIVDESHHVRCTQKASESEEIKAILDVTTKVKRKVLL 103 +VVISYTML RLRKS+ Q+W+L+IVDESHHVRC +K+SE EEIKA+LD+ TKV+ +LL Sbjct: 296 IVVISYTMLQRLRKSIFQQKWSLLIVDESHHVRCAKKSSEPEEIKAVLDLATKVQHIILL 355 Query: 102 SGTPSLSR 79 SGTPSLSR Sbjct: 356 SGTPSLSR 363 Score = 38.5 bits (88), Expect(2) = 6e-26 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 71 RPYDIFHQIDMLWPGLLGTNKYE 3 RPYDIFHQI+M PGLLG KYE Sbjct: 363 RPYDIFHQINM--PGLLGKTKYE 383 >ref|XP_002514699.1| ATP binding protein, putative [Ricinus communis] gi|223546303|gb|EEF47805.1| ATP binding protein, putative [Ricinus communis] Length = 1229 Score = 104 bits (260), Expect(2) = 6e-26 Identities = 52/68 (76%), Positives = 58/68 (85%) Frame = -1 Query: 282 VVVISYTMLHRLRKSMLAQEWALMIVDESHHVRCTQKASESEEIKAILDVTTKVKRKVLL 103 VVVIS+ MLH L KSML +EWAL+IVDESHHVRC++K SE EIKA+LDV KVKR VLL Sbjct: 303 VVVISFKMLHHLGKSMLEREWALLIVDESHHVRCSKKKSEPNEIKAVLDVAAKVKRMVLL 362 Query: 102 SGTPSLSR 79 SGTPSLSR Sbjct: 363 SGTPSLSR 370 Score = 37.7 bits (86), Expect(2) = 6e-26 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 71 RPYDIFHQIDMLWPGLLGTNKYE 3 RPYDIFHQI+M PGLLG +KY+ Sbjct: 370 RPYDIFHQINM--PGLLGQSKYD 390