BLASTX nr result
ID: Cimicifuga21_contig00040596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00040596 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285452.1| PREDICTED: U-box domain-containing protein 7... 59 4e-07 ref|XP_003574025.1| PREDICTED: U-box domain-containing protein 7... 59 5e-07 emb|CAN74844.1| hypothetical protein VITISV_037043 [Vitis vinifera] 58 7e-07 ref|XP_002528359.1| Pre-mRNA-splicing factor, putative [Ricinus ... 58 9e-07 ref|XP_003555746.1| PREDICTED: U-box domain-containing protein 7... 57 1e-06 >ref|XP_002285452.1| PREDICTED: U-box domain-containing protein 72 [Vitis vinifera] gi|296083725|emb|CBI23714.3| unnamed protein product [Vitis vinifera] Length = 524 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 210 YPPDIIATGGVDSNAVLFDRTSGQIVSSLNGYSKKV 103 Y DIIATGGVD+NAVLFDR SGQI+S+L+G+SKKV Sbjct: 234 YSKDIIATGGVDANAVLFDRQSGQILSTLSGHSKKV 269 >ref|XP_003574025.1| PREDICTED: U-box domain-containing protein 72-like [Brachypodium distachyon] Length = 527 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -3 Query: 234 PGAPEKPVYPP-DIIATGGVDSNAVLFDRTSGQIVSSLNGYSKKV 103 PG ++P DIIATGG+D+NAVLFDR SGQI+S+L+G+SKK+ Sbjct: 222 PGILSMDIHPSKDIIATGGIDTNAVLFDRPSGQILSTLSGHSKKI 266 >emb|CAN74844.1| hypothetical protein VITISV_037043 [Vitis vinifera] Length = 279 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 201 DIIATGGVDSNAVLFDRTSGQIVSSLNGYSKKV 103 DIIATGGVDSNAVLFDR SGQI+S+L+G+SKKV Sbjct: 115 DIIATGGVDSNAVLFDRQSGQILSTLSGHSKKV 147 >ref|XP_002528359.1| Pre-mRNA-splicing factor, putative [Ricinus communis] gi|223532227|gb|EEF34031.1| Pre-mRNA-splicing factor, putative [Ricinus communis] Length = 531 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 210 YPPDIIATGGVDSNAVLFDRTSGQIVSSLNGYSKKV 103 Y DIIATGGVDS AVLFDR SGQI+S+L+G+SKKV Sbjct: 234 YSKDIIATGGVDSTAVLFDRPSGQILSTLSGHSKKV 269 >ref|XP_003555746.1| PREDICTED: U-box domain-containing protein 72 [Glycine max] Length = 525 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = -3 Query: 213 VYPPDIIATGGVDSNAVLFDRTSGQIVSSLNGYSKKV 103 +Y D+IATGG+D+NAV+FDR SGQI+S+L+G+SKKV Sbjct: 233 LYSKDLIATGGIDTNAVIFDRPSGQILSTLSGHSKKV 269