BLASTX nr result
ID: Cimicifuga21_contig00040437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00040437 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFA82107.1| p34-cdc2 protein [Polysphondylium pallidum PN500] 56 3e-06 gb|EFW42773.1| cell division cycle 2 [Capsaspora owczarzaki ATCC... 55 5e-06 gb|EGG20971.1| p34-cdc2 protein [Dictyostelium fasciculatum] 55 6e-06 gb|EJY64895.1| Protein kinase domain containing protein [Oxytric... 55 8e-06 >gb|EFA82107.1| p34-cdc2 protein [Polysphondylium pallidum PN500] Length = 297 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/60 (41%), Positives = 41/60 (68%) Frame = +3 Query: 48 DFNMTKYIEEKKIGAGNFGNVYLYTNKETGEKVAIKKILLPDDGYTTSMIREVSILRRLK 227 D +++Y + +K+G G +G VY K TG+ VA+KKI L DDG ++ +RE+S+L+ L+ Sbjct: 5 DGGLSRYQKLEKLGEGTYGKVYKAKEKSTGKTVALKKIRLEDDGVPSTALREISLLKELQ 64 >gb|EFW42773.1| cell division cycle 2 [Capsaspora owczarzaki ATCC 30864] Length = 106 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = +3 Query: 57 MTKYIEEKKIGAGNFGNVYLYTNKETGEKVAIKKILL--PDDGYTTSMIREVSILRRL 224 M Y +E+KIG G +G VY T+K TGE VA+KKI L D+G ++ IRE+S+L+ L Sbjct: 1 MDNYTKEEKIGEGTYGIVYKATDKRTGEYVAMKKIRLESQDEGVPSTAIREISLLKEL 58 >gb|EGG20971.1| p34-cdc2 protein [Dictyostelium fasciculatum] Length = 297 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/60 (43%), Positives = 40/60 (66%) Frame = +3 Query: 45 IDFNMTKYIEEKKIGAGNFGNVYLYTNKETGEKVAIKKILLPDDGYTTSMIREVSILRRL 224 +D +++Y + +K+G G +G VY K TG VA+KKI L DDG ++ +RE+SIL+ L Sbjct: 4 LDGGLSRYHKLEKLGEGTYGKVYKAKEKTTGRIVALKKIRLEDDGVPSTALREISILKDL 63 >gb|EJY64895.1| Protein kinase domain containing protein [Oxytricha trifallax] Length = 349 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/57 (50%), Positives = 40/57 (70%), Gaps = 2/57 (3%) Frame = +3 Query: 63 KYIEEKKIGAGNFGNVYLYTNKETGEKVAIKKILL--PDDGYTTSMIREVSILRRLK 227 KY + +K+G G +G VY +KETGE VA+KKI L DDG ++ IRE+S+L+ LK Sbjct: 54 KYKKLEKLGEGTYGVVYKAIHKETGETVALKKIRLEKEDDGVPSTAIREISLLKSLK 110