BLASTX nr result
ID: Cimicifuga21_contig00039890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00039890 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB10336.1| splicing factor like protein [Arabidopsis thalia... 55 6e-06 >emb|CAB10336.1| splicing factor like protein [Arabidopsis thaliana] gi|7268306|emb|CAB78600.1| splicing factor like protein [Arabidopsis thaliana] Length = 559 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/49 (42%), Positives = 37/49 (75%) Frame = +2 Query: 143 IGWRFPPANYLKLNTNGSSIENPGPAGAGGILRDDNGMFLLAFSIPIFF 289 I W PP ++K++T+G+S NPGPA AGG++RD++G+++ F++ + F Sbjct: 26 IAWTKPPEGWVKVSTDGASRGNPGPAAAGGVIRDEDGLWVGGFALQLAF 74