BLASTX nr result
ID: Cimicifuga21_contig00039270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00039270 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275546.2| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 ref|XP_002532711.1| pentatricopeptide repeat-containing protein,... 99 3e-19 ref|XP_002299387.1| predicted protein [Populus trichocarpa] gi|2... 98 6e-19 ref|XP_002878152.1| hypothetical protein ARALYDRAFT_486188 [Arab... 96 3e-18 ref|NP_191302.2| pentatricopeptide repeat-containing protein [Ar... 92 3e-17 >ref|XP_002275546.2| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Vitis vinifera] Length = 896 Score = 107 bits (267), Expect = 1e-21 Identities = 51/73 (69%), Positives = 58/73 (79%) Frame = -3 Query: 227 RRVFDRLLERKIPLWNAMIAGYAQNGFFEEALSLYIEMEVDAGLFPNPTTMASVLPACVH 48 RRVFD +L R+I LWNAMI+GYA+NG E+AL L+IEM AGL PN TTMASV+PACVH Sbjct: 353 RRVFDHILGRRIELWNAMISGYARNGLDEKALILFIEMIKVAGLLPNTTTMASVMPACVH 412 Query: 47 CEKFPQKEGIHGY 9 CE F KE IHGY Sbjct: 413 CEAFSNKESIHGY 425 >ref|XP_002532711.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527557|gb|EEF29678.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 679 Score = 99.4 bits (246), Expect = 3e-19 Identities = 49/74 (66%), Positives = 55/74 (74%) Frame = -3 Query: 227 RRVFDRLLERKIPLWNAMIAGYAQNGFFEEALSLYIEMEVDAGLFPNPTTMASVLPACVH 48 RRVFD +LERK LWNAMIAGYAQN E+AL L+IEM AGL PN TTMAS++PA Sbjct: 338 RRVFDGILERKTGLWNAMIAGYAQNEHDEKALMLFIEMVAVAGLCPNTTTMASIVPASAR 397 Query: 47 CEKFPQKEGIHGYI 6 CE F KE IHGY+ Sbjct: 398 CESFFSKESIHGYV 411 >ref|XP_002299387.1| predicted protein [Populus trichocarpa] gi|222846645|gb|EEE84192.1| predicted protein [Populus trichocarpa] Length = 814 Score = 98.2 bits (243), Expect = 6e-19 Identities = 47/74 (63%), Positives = 58/74 (78%) Frame = -3 Query: 227 RRVFDRLLERKIPLWNAMIAGYAQNGFFEEALSLYIEMEVDAGLFPNPTTMASVLPACVH 48 R VFD +L+RKI LWNAMIAGYAQ+ E+AL L+IEME AGL+ N TTM+S++PA V Sbjct: 272 RLVFDSVLDRKIGLWNAMIAGYAQSEHDEKALMLFIEMEAAAGLYSNATTMSSIVPAYVR 331 Query: 47 CEKFPQKEGIHGYI 6 CE +KEGIHGY+ Sbjct: 332 CEGISRKEGIHGYV 345 >ref|XP_002878152.1| hypothetical protein ARALYDRAFT_486188 [Arabidopsis lyrata subsp. lyrata] gi|297323990|gb|EFH54411.1| hypothetical protein ARALYDRAFT_486188 [Arabidopsis lyrata subsp. lyrata] Length = 886 Score = 95.9 bits (237), Expect = 3e-18 Identities = 46/73 (63%), Positives = 54/73 (73%) Frame = -3 Query: 224 RVFDRLLERKIPLWNAMIAGYAQNGFFEEALSLYIEMEVDAGLFPNPTTMASVLPACVHC 45 RVFD + +RKI LWNAMI GYAQN + EEAL L+IEME AGL N TTMA V+PACV Sbjct: 355 RVFDGMFDRKIGLWNAMITGYAQNEYDEEALLLFIEMEESAGLLANSTTMAGVVPACVRS 414 Query: 44 EKFPQKEGIHGYI 6 F +KE IHG++ Sbjct: 415 GAFSKKEAIHGFV 427 >ref|NP_191302.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218525905|sp|Q7Y211.2|PP285_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g57430, chloroplastic; Flags: Precursor gi|332646133|gb|AEE79654.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 890 Score = 92.4 bits (228), Expect = 3e-17 Identities = 45/74 (60%), Positives = 54/74 (72%) Frame = -3 Query: 227 RRVFDRLLERKIPLWNAMIAGYAQNGFFEEALSLYIEMEVDAGLFPNPTTMASVLPACVH 48 RRVFD + +RKI LWNAMIAGY+QN +EAL L+I ME AGL N TTMA V+PACV Sbjct: 358 RRVFDGMFDRKIGLWNAMIAGYSQNEHDKEALLLFIGMEESAGLLANSTTMAGVVPACVR 417 Query: 47 CEKFPQKEGIHGYI 6 F +KE IHG++ Sbjct: 418 SGAFSRKEAIHGFV 431