BLASTX nr result
ID: Cimicifuga21_contig00039198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00039198 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67605.1| hypothetical protein VITISV_030993 [Vitis vinifera] 58 7e-07 >emb|CAN67605.1| hypothetical protein VITISV_030993 [Vitis vinifera] Length = 1290 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/57 (45%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = -3 Query: 164 LMANWSEFPNDIVDLFAQQLHRVEDFVQFGSVCKSWRDVALQRK---HKPFAPWLML 3 +MA+WS+ P+D + L A++LH VED+V+FG VCKSW + ++ +PWLML Sbjct: 918 VMADWSKMPDDPLKLIAEKLHSVEDYVRFGGVCKSWYSIFEDKECCCPSSKSPWLML 974