BLASTX nr result
ID: Cimicifuga21_contig00038824
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00038824 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB57671.1| pectinesterase [Citrus sinensis] 84 2e-14 ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinu... 84 2e-14 sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE ... 84 2e-14 ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sa... 83 2e-14 emb|CBI24581.3| unnamed protein product [Vitis vinifera] 83 3e-14 >gb|AAB57671.1| pectinesterase [Citrus sinensis] Length = 510 Score = 83.6 bits (205), Expect = 2e-14 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -1 Query: 273 PSSSTTRRVKWGGYRVITNPSEASQFTVGNFIAGQSWLPATGVPFTAGL 127 P SST RVKW GY V+T+PS+ SQFTVGNFIAG SWLPAT VPFT+GL Sbjct: 462 PGSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL 510 >ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis] gi|223550055|gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis] Length = 455 Score = 83.6 bits (205), Expect = 2e-14 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = -1 Query: 273 PSSSTTRRVKWGGYRVITNPSEASQFTVGNFIAGQSWLPATGVPFTAGL 127 P+SST+ RVKW GYRVIT+ +EASQFTV NFIAG+SWLPATGVPF++GL Sbjct: 407 PASSTSGRVKWRGYRVITSATEASQFTVANFIAGRSWLPATGVPFSSGL 455 >sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin methylesterase; Flags: Precursor gi|2098709|gb|AAB57669.1| pectinesterase [Citrus sinensis] Length = 510 Score = 83.6 bits (205), Expect = 2e-14 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -1 Query: 273 PSSSTTRRVKWGGYRVITNPSEASQFTVGNFIAGQSWLPATGVPFTAGL 127 P SST RVKW GY V+T+PS+ SQFTVGNFIAG SWLPAT VPFT+GL Sbjct: 462 PGSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL 510 >ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus] Length = 520 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -1 Query: 273 PSSSTTRRVKWGGYRVITNPSEASQFTVGNFIAGQSWLPATGVPFTAGL 127 P SST RVKW GYRVIT+ SEA++FTVG+FIAG SWLP TGVPFTAGL Sbjct: 472 PGSSTANRVKWKGYRVITSASEAAKFTVGSFIAGNSWLPGTGVPFTAGL 520 >emb|CBI24581.3| unnamed protein product [Vitis vinifera] Length = 255 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = -1 Query: 273 PSSSTTRRVKWGGYRVITNPSEASQFTVGNFIAGQSWLPATGVPFTAGL 127 PSSST RVKW GY VIT+ + AS+FTVG+FIAGQSWLPATGVPFT+GL Sbjct: 207 PSSSTRNRVKWSGYHVITSATVASRFTVGSFIAGQSWLPATGVPFTSGL 255