BLASTX nr result
ID: Cimicifuga21_contig00038718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00038718 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE64566.1| hypothetical protein OsJ_19418 [Oryza sativa Japo... 91 1e-16 gb|EEC79635.1| hypothetical protein OsI_20852 [Oryza sativa Indi... 91 1e-16 gb|AAT44179.1| putative regulator of chromosome condensation pro... 91 1e-16 gb|AFW78981.1| putative regulator of chromosome condensation (RC... 90 2e-16 ref|XP_002441460.1| hypothetical protein SORBIDRAFT_09g027250 [S... 90 2e-16 >gb|EEE64566.1| hypothetical protein OsJ_19418 [Oryza sativa Japonica Group] Length = 1002 Score = 90.5 bits (223), Expect = 1e-16 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +3 Query: 3 QFEPGVYITLVQLQNGTKMFKRVRFSKRKFSGQQAEYWWRENSSRVLQKYNNNNN 167 QFEPGVY+TL+QL++GTK+FKRVRFSKR+F+ QQAE WWREN RV +KYN+ N Sbjct: 948 QFEPGVYVTLIQLRDGTKVFKRVRFSKRRFAEQQAEEWWRENQERVFKKYNHPTN 1002 >gb|EEC79635.1| hypothetical protein OsI_20852 [Oryza sativa Indica Group] Length = 1038 Score = 90.5 bits (223), Expect = 1e-16 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +3 Query: 3 QFEPGVYITLVQLQNGTKMFKRVRFSKRKFSGQQAEYWWRENSSRVLQKYNNNNN 167 QFEPGVY+TL+QL++GTK+FKRVRFSKR+F+ QQAE WWREN RV +KYN+ N Sbjct: 984 QFEPGVYVTLIQLRDGTKVFKRVRFSKRRFAEQQAEEWWRENQERVFKKYNHPTN 1038 >gb|AAT44179.1| putative regulator of chromosome condensation protein [Oryza sativa Japonica Group] gi|52353417|gb|AAU43985.1| putative regulator of chromosome condensation protein [Oryza sativa Japonica Group] Length = 1064 Score = 90.5 bits (223), Expect = 1e-16 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +3 Query: 3 QFEPGVYITLVQLQNGTKMFKRVRFSKRKFSGQQAEYWWRENSSRVLQKYNNNNN 167 QFEPGVY+TL+QL++GTK+FKRVRFSKR+F+ QQAE WWREN RV +KYN+ N Sbjct: 1010 QFEPGVYVTLIQLRDGTKVFKRVRFSKRRFAEQQAEEWWRENQERVFKKYNHPTN 1064 >gb|AFW78981.1| putative regulator of chromosome condensation (RCC1) family protein [Zea mays] Length = 1009 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +3 Query: 3 QFEPGVYITLVQLQNGTKMFKRVRFSKRKFSGQQAEYWWRENSSRVLQKYNNNNN 167 QFEPGVY+TL+QL++GTK+FKRVRFSKR+F+ QQAE WWREN RV +KYN+ N Sbjct: 955 QFEPGVYVTLIQLRDGTKVFKRVRFSKRRFAEQQAEEWWRENQERVFRKYNHPAN 1009 >ref|XP_002441460.1| hypothetical protein SORBIDRAFT_09g027250 [Sorghum bicolor] gi|241946745|gb|EES19890.1| hypothetical protein SORBIDRAFT_09g027250 [Sorghum bicolor] Length = 1020 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +3 Query: 3 QFEPGVYITLVQLQNGTKMFKRVRFSKRKFSGQQAEYWWRENSSRVLQKYNNNNN 167 QFEPGVY+TL+QL++GTK+FKRVRFSKR+F+ QQAE WWREN RV +KYN+ N Sbjct: 966 QFEPGVYVTLIQLRDGTKVFKRVRFSKRRFAEQQAEEWWRENQERVFRKYNHPAN 1020