BLASTX nr result
ID: Cimicifuga21_contig00038400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00038400 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis] 186 2e-45 ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arab... 185 4e-45 dbj|BAF01762.1| cysteine protease component of protease-inhibito... 185 4e-45 ref|NP_568620.1| Granulin repeat cysteine protease family protei... 185 4e-45 dbj|BAD29954.1| cysteine protease [Daucus carota] 184 5e-45 >dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis] Length = 431 Score = 186 bits (471), Expect = 2e-45 Identities = 85/104 (81%), Positives = 98/104 (94%) Frame = +2 Query: 2 KIVTGDLISLSEQELVDCDTSYNSGCNGGLMDYAFEFIIKNGGIDTEKDYPYKAVDGQCD 181 KIVTGDLISLSEQELVDCDTSYN GCNGGLMDYAFEFIIKNGGIDTE+DYPYK VDG+CD Sbjct: 164 KIVTGDLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDTEEDYPYKGVDGRCD 223 Query: 182 KSRKNARVASIDGYEDVPANDEKALQRAVAHQPVSVAIEAGGRA 313 ++RKNA+V +ID YEDVPAN E++L++A++HQP+SVAIE GGRA Sbjct: 224 QTRKNAKVVTIDSYEDVPANSEESLKKALSHQPISVAIEGGGRA 267 >ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. lyrata] gi|297309532|gb|EFH39956.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. lyrata] Length = 463 Score = 185 bits (469), Expect = 4e-45 Identities = 86/104 (82%), Positives = 96/104 (92%) Frame = +2 Query: 2 KIVTGDLISLSEQELVDCDTSYNSGCNGGLMDYAFEFIIKNGGIDTEKDYPYKAVDGQCD 181 KIVTGDLISLSEQELVDCDTSYN GCNGGLMDYAFEFIIKNGGIDTE DYPYKA DG+CD Sbjct: 176 KIVTGDLISLSEQELVDCDTSYNQGCNGGLMDYAFEFIIKNGGIDTEADYPYKAADGRCD 235 Query: 182 KSRKNARVASIDGYEDVPANDEKALQRAVAHQPVSVAIEAGGRA 313 ++RKNA+V +ID YEDVP N E +L++A+AHQP+SVAIEAGGRA Sbjct: 236 QNRKNAKVVTIDSYEDVPENSEASLKKALAHQPISVAIEAGGRA 279 >dbj|BAF01762.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] Length = 300 Score = 185 bits (469), Expect = 4e-45 Identities = 86/104 (82%), Positives = 96/104 (92%) Frame = +2 Query: 2 KIVTGDLISLSEQELVDCDTSYNSGCNGGLMDYAFEFIIKNGGIDTEKDYPYKAVDGQCD 181 KIVTGDLISLSEQELVDCDTSYN GCNGGLMDYAFEFIIKNGGIDTE DYPYKA DG+CD Sbjct: 13 KIVTGDLISLSEQELVDCDTSYNQGCNGGLMDYAFEFIIKNGGIDTEADYPYKAADGRCD 72 Query: 182 KSRKNARVASIDGYEDVPANDEKALQRAVAHQPVSVAIEAGGRA 313 ++RKNA+V +ID YEDVP N E +L++A+AHQP+SVAIEAGGRA Sbjct: 73 QNRKNAKVVTIDSYEDVPENSEASLKKALAHQPISVAIEAGGRA 116 >ref|NP_568620.1| Granulin repeat cysteine protease family protein [Arabidopsis thaliana] gi|9757832|dbj|BAB08269.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] gi|17065064|gb|AAL32686.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] gi|21387153|gb|AAM47980.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] gi|332007522|gb|AED94905.1| Granulin repeat cysteine protease family protein [Arabidopsis thaliana] Length = 463 Score = 185 bits (469), Expect = 4e-45 Identities = 86/104 (82%), Positives = 96/104 (92%) Frame = +2 Query: 2 KIVTGDLISLSEQELVDCDTSYNSGCNGGLMDYAFEFIIKNGGIDTEKDYPYKAVDGQCD 181 KIVTGDLISLSEQELVDCDTSYN GCNGGLMDYAFEFIIKNGGIDTE DYPYKA DG+CD Sbjct: 176 KIVTGDLISLSEQELVDCDTSYNQGCNGGLMDYAFEFIIKNGGIDTEADYPYKAADGRCD 235 Query: 182 KSRKNARVASIDGYEDVPANDEKALQRAVAHQPVSVAIEAGGRA 313 ++RKNA+V +ID YEDVP N E +L++A+AHQP+SVAIEAGGRA Sbjct: 236 QNRKNAKVVTIDSYEDVPENSEASLKKALAHQPISVAIEAGGRA 279 >dbj|BAD29954.1| cysteine protease [Daucus carota] Length = 474 Score = 184 bits (468), Expect = 5e-45 Identities = 86/104 (82%), Positives = 96/104 (92%) Frame = +2 Query: 2 KIVTGDLISLSEQELVDCDTSYNSGCNGGLMDYAFEFIIKNGGIDTEKDYPYKAVDGQCD 181 KIVTG+LISLSEQELVDCD YN GCNGGLMDYAFEFI+KNGGIDTE DYPYK VDG CD Sbjct: 188 KIVTGELISLSEQELVDCDNGYNQGCNGGLMDYAFEFIVKNGGIDTEDDYPYKGVDGLCD 247 Query: 182 KSRKNARVASIDGYEDVPANDEKALQRAVAHQPVSVAIEAGGRA 313 ++RKNA+V +I+GYEDVP NDEK+L++AVAHQPVSVAIEAGGRA Sbjct: 248 QNRKNAKVVTINGYEDVPHNDEKSLKKAVAHQPVSVAIEAGGRA 291