BLASTX nr result
ID: Cimicifuga21_contig00038366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00038366 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541512.1| PREDICTED: glutamate receptor 2.7-like [Glyc... 78 9e-13 emb|CBI30649.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_002272216.1| PREDICTED: glutamate receptor 2.7-like [Viti... 77 1e-12 ref|XP_002522526.1| glutamate receptor 2 plant, putative [Ricinu... 75 4e-12 ref|XP_003541715.1| PREDICTED: glutamate receptor 2.7-like [Glyc... 75 6e-12 >ref|XP_003541512.1| PREDICTED: glutamate receptor 2.7-like [Glycine max] Length = 816 Score = 77.8 bits (190), Expect = 9e-13 Identities = 35/68 (51%), Positives = 47/68 (69%) Frame = +3 Query: 3 DIDMLSKNNKRVGCDNDSFIKKYLEDVLHYPSENIIPILGEKEYPNAFKNGTINVAFLES 182 DI +L NNK++GCD DSF++ YLE V + ENII I E Y +AFKN +I AFLE Sbjct: 628 DIQILKNNNKKIGCDGDSFVRTYLETVEEFKPENIINIGSENSYDDAFKNNSIAAAFLEL 687 Query: 183 PYARVFLA 206 PY +V+++ Sbjct: 688 PYEKVYIS 695 >emb|CBI30649.3| unnamed protein product [Vitis vinifera] Length = 924 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/67 (52%), Positives = 46/67 (68%) Frame = +3 Query: 3 DIDMLSKNNKRVGCDNDSFIKKYLEDVLHYPSENIIPILGEKEYPNAFKNGTINVAFLES 182 DI+ L + VGCD DSF++KYLEDVL + +NI I + YPN F+ GTI+ AFLE Sbjct: 686 DIEWLKVHKLNVGCDGDSFVRKYLEDVLDFKKDNIKNISSQYAYPNEFQKGTISAAFLEL 745 Query: 183 PYARVFL 203 PY +VF+ Sbjct: 746 PYEKVFM 752 >ref|XP_002272216.1| PREDICTED: glutamate receptor 2.7-like [Vitis vinifera] Length = 916 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/67 (52%), Positives = 46/67 (68%) Frame = +3 Query: 3 DIDMLSKNNKRVGCDNDSFIKKYLEDVLHYPSENIIPILGEKEYPNAFKNGTINVAFLES 182 DI+ L + VGCD DSF++KYLEDVL + +NI I + YPN F+ GTI+ AFLE Sbjct: 678 DIEWLKVHKLNVGCDGDSFVRKYLEDVLDFKKDNIKNISSQYAYPNEFQKGTISAAFLEL 737 Query: 183 PYARVFL 203 PY +VF+ Sbjct: 738 PYEKVFM 744 >ref|XP_002522526.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223538217|gb|EEF39826.1| glutamate receptor 2 plant, putative [Ricinus communis] Length = 843 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/67 (52%), Positives = 45/67 (67%) Frame = +3 Query: 3 DIDMLSKNNKRVGCDNDSFIKKYLEDVLHYPSENIIPILGEKEYPNAFKNGTINVAFLES 182 DI+ L +NN VGCD DSF++KYLE+VL + ENI + E YP F+ TI AFLE Sbjct: 608 DIEWLKRNNLPVGCDGDSFVRKYLENVLQFRPENIKNVSSEYSYPGEFQKKTIYAAFLEL 667 Query: 183 PYARVFL 203 PY +VF+ Sbjct: 668 PYQKVFM 674 >ref|XP_003541715.1| PREDICTED: glutamate receptor 2.7-like [Glycine max] Length = 910 Score = 75.1 bits (183), Expect = 6e-12 Identities = 33/68 (48%), Positives = 46/68 (67%) Frame = +3 Query: 3 DIDMLSKNNKRVGCDNDSFIKKYLEDVLHYPSENIIPILGEKEYPNAFKNGTINVAFLES 182 DI L +NN ++GCD DSF++ +LE V ++ ENII + E Y AFKN +I AFLE Sbjct: 640 DIQWLKRNNMKIGCDGDSFVRSFLEKVENFKPENIINVTDEYNYDGAFKNNSIAAAFLEL 699 Query: 183 PYARVFLA 206 PY +VF++ Sbjct: 700 PYEKVFIS 707