BLASTX nr result
ID: Cimicifuga21_contig00038203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00038203 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF79665.1|AC022314_6 F9C16.13 [Arabidopsis thaliana] 58 7e-07 gb|AAF79683.1|AC022314_24 F9C16.17 [Arabidopsis thaliana] 58 9e-07 >gb|AAF79665.1|AC022314_6 F9C16.13 [Arabidopsis thaliana] Length = 1172 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 132 LVENEDVVLEHVVTEKQHADLFTKPLDFNRFIDLRKLIGLCSL 4 LVE + +V+ HV +E Q ADLFTKPLDFNRFI LR IG+C L Sbjct: 1130 LVEAKQIVIGHVGSEHQLADLFTKPLDFNRFISLRPSIGVCEL 1172 >gb|AAF79683.1|AC022314_24 F9C16.17 [Arabidopsis thaliana] Length = 873 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 132 LVENEDVVLEHVVTEKQHADLFTKPLDFNRFIDLRKLIGLCSL 4 LVE + +V+ HV E Q ADLFTKPLDFNRFI LR IG+C L Sbjct: 831 LVEAKQIVIGHVGNEHQLADLFTKPLDFNRFISLRPSIGVCEL 873