BLASTX nr result
ID: Cimicifuga21_contig00037413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00037413 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520359.1| porphobilinogen deaminase, putative [Ricinus... 55 6e-06 >ref|XP_002520359.1| porphobilinogen deaminase, putative [Ricinus communis] gi|223540457|gb|EEF42025.1| porphobilinogen deaminase, putative [Ricinus communis] Length = 372 Score = 55.1 bits (131), Expect = 6e-06 Identities = 36/68 (52%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = -3 Query: 202 SKVPIFEVSPPCLKTHSSDHVRKLMLTRASVSNEHQTQT-KYPLLRIGARGSPLTLTWAC 26 S +P F+ SP C+K S L +TRASV+ E QTQ K L+RIG RGSPL L A Sbjct: 28 SSLPQFK-SPNCIKKQS------LRITRASVAVEQQTQDPKVALIRIGTRGSPLALAQAH 80 Query: 25 ETREKLIA 2 ETR+KL+A Sbjct: 81 ETRDKLMA 88