BLASTX nr result
ID: Cimicifuga21_contig00037377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00037377 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555883.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_002303012.1| predicted protein [Populus trichocarpa] gi|2... 65 4e-09 ref|XP_002884925.1| predicted protein [Arabidopsis lyrata subsp.... 65 6e-09 gb|EEC84744.1| hypothetical protein OsI_31741 [Oryza sativa Indi... 65 6e-09 ref|XP_004157227.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 65 8e-09 >ref|XP_003555883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Glycine max] Length = 618 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 295 FMKLVSKIAGKNIIVRDTNRFHHFRDGSCSCGDFW 191 FMKLVSK + IIVRDTNRFHHF+DG CSCG+FW Sbjct: 584 FMKLVSKSTSREIIVRDTNRFHHFKDGFCSCGEFW 618 >ref|XP_002303012.1| predicted protein [Populus trichocarpa] gi|222844738|gb|EEE82285.1| predicted protein [Populus trichocarpa] Length = 815 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 292 MKLVSKIAGKNIIVRDTNRFHHFRDGSCSCGDFW 191 +K++SKI G+ I VRD+NRFHHFRDGSCSCGD+W Sbjct: 782 IKVISKIVGREITVRDSNRFHHFRDGSCSCGDYW 815 >ref|XP_002884925.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330765|gb|EFH61184.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 694 Score = 65.1 bits (157), Expect = 6e-09 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -3 Query: 289 KLVSKIAGKNIIVRDTNRFHHFRDGSCSCGDFW 191 KL+SK+ G+ I+VRDTNRFHHF+DG CSCGD+W Sbjct: 662 KLISKLVGREIVVRDTNRFHHFKDGVCSCGDYW 694 >gb|EEC84744.1| hypothetical protein OsI_31741 [Oryza sativa Indica Group] Length = 563 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 292 MKLVSKIAGKNIIVRDTNRFHHFRDGSCSCGDFW 191 +KL+SKI G+ IIVRD NRFHHFR+GSCSCGDFW Sbjct: 530 VKLLSKIYGRCIIVRDANRFHHFREGSCSCGDFW 563 >ref|XP_004157227.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cucumis sativus] Length = 863 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 289 KLVSKIAGKNIIVRDTNRFHHFRDGSCSCGDFW 191 K +SK+A + IIVRD NRFHHFRDGSCSCGD+W Sbjct: 831 KFISKVASREIIVRDINRFHHFRDGSCSCGDYW 863