BLASTX nr result
ID: Cimicifuga21_contig00037215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00037215 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313710.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|XP_002277777.1| PREDICTED: uncharacterized protein LOC100250... 55 6e-06 ref|XP_002530818.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002313710.1| predicted protein [Populus trichocarpa] gi|222850118|gb|EEE87665.1| predicted protein [Populus trichocarpa] Length = 283 Score = 66.2 bits (160), Expect = 3e-09 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = +1 Query: 73 RVLETPPASPSSLHPQSPDYLSDRGSLRRMGKADMSVFRDSVGEYLEDVPIVVDKA 240 RVLETPP SPS+ H SP YLSD GS RR G+AD+SVFRD+V + L+ P V KA Sbjct: 18 RVLETPPGSPSNHHSLSPGYLSDDGSPRRKGQADLSVFRDAVQDCLDYEPKPVVKA 73 >ref|XP_002277777.1| PREDICTED: uncharacterized protein LOC100250259 [Vitis vinifera] Length = 403 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/57 (56%), Positives = 38/57 (66%) Frame = +1 Query: 73 RVLETPPASPSSLHPQSPDYLSDRGSLRRMGKADMSVFRDSVGEYLEDVPIVVDKAP 243 RVLETPP SP QSP YLSD GS R ++DMSVFR++V + L+ P V KAP Sbjct: 17 RVLETPPHSPG----QSPGYLSDDGSPTRTRQSDMSVFRNAVQDCLDFEPESVKKAP 69 >ref|XP_002530818.1| conserved hypothetical protein [Ricinus communis] gi|223529610|gb|EEF31558.1| conserved hypothetical protein [Ricinus communis] Length = 348 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +1 Query: 73 RVLETPPASPSSLHPQSPDYLSDRGSLRRMGKADMSVFRDSVGEYL 210 RVLETPP SPS+L+ S +LSD S RR G+AD+SVFRD+V + L Sbjct: 17 RVLETPPGSPSNLNANSLGFLSDDESPRRRGQADLSVFRDAVQDCL 62