BLASTX nr result
ID: Cimicifuga21_contig00037023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00037023 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE67670.1| hypothetical protein OsJ_25298 [Oryza sativa Japo... 75 4e-12 gb|EEC82526.1| hypothetical protein OsI_27039 [Oryza sativa Indi... 75 4e-12 sp|Q8GVF9.1|4CLL8_ORYSJ RecName: Full=Putative 4-coumarate--CoA ... 75 4e-12 gb|ADE75597.1| unknown [Picea sitchensis] 70 2e-10 ref|XP_002509558.1| AMP dependent CoA ligase, putative [Ricinus ... 70 2e-10 >gb|EEE67670.1| hypothetical protein OsJ_25298 [Oryza sativa Japonica Group] Length = 362 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -2 Query: 294 KKGMSEVEEEDIISFVANKVAPYKKIRKVMFVDSIPKSASGKILRRHLKD 145 K+G ++E+++ISFV NKVAPYKKIRKV+FVDSIP+S SGKILRR LK+ Sbjct: 301 KQGSGHLQEDEVISFVQNKVAPYKKIRKVVFVDSIPRSPSGKILRRQLKN 350 >gb|EEC82526.1| hypothetical protein OsI_27039 [Oryza sativa Indica Group] Length = 608 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -2 Query: 294 KKGMSEVEEEDIISFVANKVAPYKKIRKVMFVDSIPKSASGKILRRHLKD 145 K+G ++E+++ISFV NKVAPYKKIRKV+FVDSIP+S SGKILRR LK+ Sbjct: 547 KQGSGHLQEDEVISFVQNKVAPYKKIRKVVFVDSIPRSPSGKILRRQLKN 596 >sp|Q8GVF9.1|4CLL8_ORYSJ RecName: Full=Putative 4-coumarate--CoA ligase-like 8 gi|27261095|dbj|BAC45208.1| putative 4-coumarate--CoA ligase [Oryza sativa Japonica Group] Length = 609 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -2 Query: 294 KKGMSEVEEEDIISFVANKVAPYKKIRKVMFVDSIPKSASGKILRRHLKD 145 K+G ++E+++ISFV NKVAPYKKIRKV+FVDSIP+S SGKILRR LK+ Sbjct: 548 KQGSGHLQEDEVISFVQNKVAPYKKIRKVVFVDSIPRSPSGKILRRQLKN 597 >gb|ADE75597.1| unknown [Picea sitchensis] Length = 163 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/56 (60%), Positives = 46/56 (82%) Frame = -2 Query: 297 VKKGMSEVEEEDIISFVANKVAPYKKIRKVMFVDSIPKSASGKILRRHLKDKALTT 130 V+K S + EED+I+FV+ +V+PYKKIR+V FV+SIPKS SGKILR+ L +AL+T Sbjct: 105 VRKSDSNLSEEDVINFVSKQVSPYKKIRRVAFVNSIPKSPSGKILRKDLIHQALST 160 >ref|XP_002509558.1| AMP dependent CoA ligase, putative [Ricinus communis] gi|223549457|gb|EEF50945.1| AMP dependent CoA ligase, putative [Ricinus communis] Length = 540 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = -2 Query: 297 VKKGMSEVEEEDIISFVANKVAPYKKIRKVMFVDSIPKSASGKILRRHLKDKALTTY 127 VK+ S + E+DI+ FVA +VAPYKKIR+V FV+SIPKS SGKILR+ L+D L + Sbjct: 480 VKQPQSSLNEKDIMDFVAKQVAPYKKIRRVAFVNSIPKSPSGKILRKDLRDMILPAF 536