BLASTX nr result
ID: Cimicifuga21_contig00036940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00036940 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276540.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_002276540.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Vitis vinifera] gi|296082481|emb|CBI21486.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 54.7 bits (130), Expect = 8e-06 Identities = 36/72 (50%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Frame = -2 Query: 211 MPSMVSTL--SLQLNSITPFSPKFKEPTISEFKPTHLRLQTRILNNPITRINPVSTRPRR 38 MPS+VS+ SLQL S + SP F P+ +KPT L L R T ++ VSTRPRR Sbjct: 1 MPSIVSSSPSSLQLYSSSTLSPTFTLPSSRFYKPTRLHLPPR---PSTTVVSCVSTRPRR 57 Query: 37 KSGSKVDKSETE 2 K G K DKSE E Sbjct: 58 KPGPKPDKSEVE 69