BLASTX nr result
ID: Cimicifuga21_contig00036905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00036905 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516306.1| Na(+)/H(+) antiporter, putative [Ricinus com... 57 2e-06 ref|XP_004147368.1| PREDICTED: cation/H(+) antiporter 15-like [C... 57 2e-06 ref|XP_002883073.1| predicted protein [Arabidopsis lyrata subsp.... 56 3e-06 ref|NP_188390.2| cation/H(+) antiporter 19 [Arabidopsis thaliana... 56 3e-06 ref|XP_003522484.1| PREDICTED: cation/H(+) antiporter 15-like [G... 55 5e-06 >ref|XP_002516306.1| Na(+)/H(+) antiporter, putative [Ricinus communis] gi|223544536|gb|EEF46053.1| Na(+)/H(+) antiporter, putative [Ricinus communis] Length = 834 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/60 (43%), Positives = 40/60 (66%) Frame = +3 Query: 90 CAVPKNATMNMKMAIDKDASPIHYTFPTFLMQIVCIVIFSRLLTFILKPFRQPRVVTEII 269 C P T N + + +P+ Y+ P F++Q+ +V+ +RLL FILKPFRQPRV++EI+ Sbjct: 19 CYAPTMITTN---GVWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPFRQPRVISEIM 75 >ref|XP_004147368.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus] gi|449513321|ref|XP_004164295.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus] Length = 837 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/60 (40%), Positives = 40/60 (66%) Frame = +3 Query: 90 CAVPKNATMNMKMAIDKDASPIHYTFPTFLMQIVCIVIFSRLLTFILKPFRQPRVVTEII 269 C P T N + + +P+ Y+ P F++Q+ +V+ +R+L F+LKPFRQPRV++EI+ Sbjct: 17 CYAPTMITTN---GVWQGDNPLDYSLPLFILQLTMVVVMTRILVFLLKPFRQPRVISEIL 73 >ref|XP_002883073.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328913|gb|EFH59332.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 800 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = +3 Query: 90 CAVPKNATMNMKMAIDKDASPIHYTFPTFLMQIVCIVIFSRLLTFILKPFRQPRVVTEII 269 C P AT N ++ SP+ + P ++QIV +V+F+RLL + LKP +QPRV+ EII Sbjct: 10 CPGPMKATSNGAF---QNESPLDFALPLIILQIVLVVVFTRLLAYFLKPLKQPRVIAEII 66 >ref|NP_188390.2| cation/H(+) antiporter 19 [Arabidopsis thaliana] gi|75311599|sp|Q9LUN4.1|CHX19_ARATH RecName: Full=Cation/H(+) antiporter 19; AltName: Full=Protein CATION/H+ EXCHANGER 19; Short=AtCHX19 gi|9294151|dbj|BAB02053.1| Na+/H+ exchangeing protein-like [Arabidopsis thaliana] gi|61658327|gb|AAX49547.1| cation/H+ exchanger [Arabidopsis thaliana] gi|332642462|gb|AEE75983.1| cation/H(+) antiporter 19 [Arabidopsis thaliana] Length = 800 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = +3 Query: 90 CAVPKNATMNMKMAIDKDASPIHYTFPTFLMQIVCIVIFSRLLTFILKPFRQPRVVTEII 269 C P AT N ++ SP+ + P ++QIV +V+F+RLL + LKP +QPRV+ EII Sbjct: 10 CPGPMKATSNGAF---QNESPLDFALPLIILQIVLVVVFTRLLAYFLKPLKQPRVIAEII 66 >ref|XP_003522484.1| PREDICTED: cation/H(+) antiporter 15-like [Glycine max] Length = 827 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/60 (40%), Positives = 38/60 (63%) Frame = +3 Query: 90 CAVPKNATMNMKMAIDKDASPIHYTFPTFLMQIVCIVIFSRLLTFILKPFRQPRVVTEII 269 C P T N + + +P+ Y+ P F++Q+ +V+ +R+ FILKPFRQPRV+ EI+ Sbjct: 15 CYAPSMITTN---GVWQGDNPLEYSLPLFILQLTLVVVATRIFVFILKPFRQPRVIAEIL 71