BLASTX nr result
ID: Cimicifuga21_contig00036682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00036682 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615802.1| Ubiquitin-activating enzyme E1 [Medicago tru... 87 1e-15 ref|XP_003615801.1| Ubiquitin-activating enzyme E1 [Medicago tru... 87 1e-15 ref|XP_002526660.1| ubiquitin-activating enzyme E1, putative [Ri... 87 2e-15 ref|XP_003537305.1| PREDICTED: ubiquitin-activating enzyme E1 1-... 85 5e-15 ref|XP_003615800.1| Ubiquitin-activating enzyme E1 [Medicago tru... 85 5e-15 >ref|XP_003615802.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517137|gb|AES98760.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] Length = 1180 Score = 87.0 bits (214), Expect = 1e-15 Identities = 45/81 (55%), Positives = 57/81 (70%) Frame = -3 Query: 245 VLQHFANSSRAVLGPMASIFCGIAAHEVVKALSRDSHPIFQFLYFDSLESLPSMGRHGDS 66 +LQ FA +RAVL PMA++F GI EVVKA S HP+FQF YFDS+ESLP+ H D Sbjct: 508 LLQQFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPTEPLHPDD 567 Query: 65 THPGLPSRYDAQMLLFGHEVQ 3 P + SRYDAQ+ +FG ++Q Sbjct: 568 LKP-INSRYDAQISVFGQKLQ 587 >ref|XP_003615801.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517136|gb|AES98759.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] Length = 1179 Score = 87.0 bits (214), Expect = 1e-15 Identities = 45/81 (55%), Positives = 57/81 (70%) Frame = -3 Query: 245 VLQHFANSSRAVLGPMASIFCGIAAHEVVKALSRDSHPIFQFLYFDSLESLPSMGRHGDS 66 +LQ FA +RAVL PMA++F GI EVVKA S HP+FQF YFDS+ESLP+ H D Sbjct: 507 LLQQFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPTEPLHPDD 566 Query: 65 THPGLPSRYDAQMLLFGHEVQ 3 P + SRYDAQ+ +FG ++Q Sbjct: 567 LKP-INSRYDAQISVFGQKLQ 586 >ref|XP_002526660.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] gi|223533960|gb|EEF35682.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] Length = 1100 Score = 86.7 bits (213), Expect = 2e-15 Identities = 46/81 (56%), Positives = 57/81 (70%) Frame = -3 Query: 245 VLQHFANSSRAVLGPMASIFCGIAAHEVVKALSRDSHPIFQFLYFDSLESLPSMGRHGDS 66 +L+HFA +RAVL PMA++F GI EVVKA S HP+FQF YFDS+ESLPS D Sbjct: 428 LLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPLDHDD 487 Query: 65 THPGLPSRYDAQMLLFGHEVQ 3 P L SRYDAQ+ +FG ++Q Sbjct: 488 FRP-LNSRYDAQISVFGSKLQ 507 >ref|XP_003537305.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Glycine max] Length = 1154 Score = 85.1 bits (209), Expect = 5e-15 Identities = 44/81 (54%), Positives = 57/81 (70%) Frame = -3 Query: 245 VLQHFANSSRAVLGPMASIFCGIAAHEVVKALSRDSHPIFQFLYFDSLESLPSMGRHGDS 66 +L++FA SRAVL PMA++F GI EVVKA S HP+FQF YFDS+ESLPS + Sbjct: 482 LLRYFAFGSRAVLNPMAAVFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPLDPND 541 Query: 65 THPGLPSRYDAQMLLFGHEVQ 3 P + RYDAQ+ +FGH++Q Sbjct: 542 FRP-VNGRYDAQISVFGHKLQ 561 >ref|XP_003615800.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517135|gb|AES98758.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] Length = 1735 Score = 85.1 bits (209), Expect = 5e-15 Identities = 44/81 (54%), Positives = 57/81 (70%) Frame = -3 Query: 245 VLQHFANSSRAVLGPMASIFCGIAAHEVVKALSRDSHPIFQFLYFDSLESLPSMGRHGDS 66 +LQ FA +RAVL PMA++F GI EVVKA S HP+FQF YFDS+ESLP+ H + Sbjct: 1041 LLQQFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPTEPLHPND 1100 Query: 65 THPGLPSRYDAQMLLFGHEVQ 3 P + SRYDAQ+ +FG ++Q Sbjct: 1101 LKP-INSRYDAQISVFGQKLQ 1120