BLASTX nr result
ID: Cimicifuga21_contig00036625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00036625 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532715.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002297705.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_002322522.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002308788.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_003594084.1| F-box protein [Medicago truncatula] gi|35548... 56 3e-06 >ref|XP_002532715.1| conserved hypothetical protein [Ricinus communis] gi|223527542|gb|EEF29664.1| conserved hypothetical protein [Ricinus communis] Length = 395 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 24 HNHIVAFDIEGETFRDVPYPDYSADEHSNGIIVTALDGNLCLLCHSNFDC-HVWLMRDYG 200 +N I+AFDI ETF+ VP P++S ++ + + L+G LC +C+ +C +W+M +YG Sbjct: 236 NNSIIAFDIVNETFQQVPQPNWSDNQLNFQVDAGVLEGRLCAMCNCGHECIDLWVMEEYG 295 Query: 201 LGESW 215 + ESW Sbjct: 296 VKESW 300 >ref|XP_002297705.1| predicted protein [Populus trichocarpa] gi|222844963|gb|EEE82510.1| predicted protein [Populus trichocarpa] Length = 408 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = +3 Query: 33 IVAFDIEGETFRDVPYPDYSADEHSNGIIVTALDGNLCLLCHSNF-DCHVWLMRDYGLGE 209 IVAFD+ E F+ +P PDYS++EH + V L G LC+ C+ N +W+M++YG+ E Sbjct: 240 IVAFDLGAEEFKIIPQPDYSSNEHEMNVGV--LGGCLCVFCNKNCKQVEIWVMKEYGVKE 297 Query: 210 SW 215 SW Sbjct: 298 SW 299 >ref|XP_002322522.1| predicted protein [Populus trichocarpa] gi|222867152|gb|EEF04283.1| predicted protein [Populus trichocarpa] Length = 419 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = +3 Query: 33 IVAFDIEGETFRDVPYPDYSADEHSNGIIVTALDGNLCLLCHSNFDC-HVWLMRDYGLGE 209 ++ FDI + F ++P P+Y + S + V L+GNLC++C+ + C VW+MR+YG+ E Sbjct: 245 VLGFDIRNDKFFELPQPNYESKGMSFQVDVGVLEGNLCVMCNYEYVCVDVWVMREYGMKE 304 Query: 210 SW 215 SW Sbjct: 305 SW 306 >ref|XP_002308788.1| predicted protein [Populus trichocarpa] gi|222854764|gb|EEE92311.1| predicted protein [Populus trichocarpa] Length = 400 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Frame = +3 Query: 33 IVAFDIEGETFRDVPYPDYSADEHSNGIIVTALDGNLCLLCHSNFDC-HVWLMRDYGLGE 209 ++ FDI + F ++P PDY + + V L+GNLC++C+ C VW+M++YG+ E Sbjct: 237 VLGFDIRDDKFFELPQPDYENKGMNFHVDVGVLEGNLCVMCNYEHVCVDVWVMKEYGVKE 296 Query: 210 SW 215 SW Sbjct: 297 SW 298 >ref|XP_003594084.1| F-box protein [Medicago truncatula] gi|355483132|gb|AES64335.1| F-box protein [Medicago truncatula] Length = 772 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/61 (42%), Positives = 39/61 (63%) Frame = +3 Query: 33 IVAFDIEGETFRDVPYPDYSADEHSNGIIVTALDGNLCLLCHSNFDCHVWLMRDYGLGES 212 IV+FD+E E+FR++ PDY + I+ +D LC+LCH + VWLM++YG +S Sbjct: 635 IVSFDLETESFREILQPDYGGMSVFSPILNVMMDC-LCILCHGDTLADVWLMKEYGNEDS 693 Query: 213 W 215 W Sbjct: 694 W 694