BLASTX nr result
ID: Cimicifuga21_contig00036276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00036276 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315636.1| predicted protein [Populus trichocarpa] gi|2... 52 8e-08 emb|CBI40086.3| unnamed protein product [Vitis vinifera] 55 1e-07 ref|XP_002270874.1| PREDICTED: F-box protein SKIP14 [Vitis vinif... 55 1e-07 ref|XP_003532712.1| PREDICTED: F-box protein SKIP14-like [Glycin... 50 4e-07 ref|XP_002876943.1| F-box family protein [Arabidopsis lyrata sub... 50 8e-07 >ref|XP_002315636.1| predicted protein [Populus trichocarpa] gi|222864676|gb|EEF01807.1| predicted protein [Populus trichocarpa] Length = 449 Score = 52.4 bits (124), Expect(2) = 8e-08 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 16 DRAINIEISPKCEKLRLVSECTAESCQG-NMKRLSCRA*SIYIARCME 156 DRAI+IE+ P+C+ LRL+ +C E CQG +CRA S+ IARC++ Sbjct: 372 DRAIDIEMCPRCQNLRLIYDCPVEGCQGKEHPSQACRACSLCIARCVQ 419 Score = 28.9 bits (63), Expect(2) = 8e-08 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 161 CVNDKEYEETFGLYVPC 211 C+ND EYEETF L + C Sbjct: 423 CINDSEYEETFCLELLC 439 >emb|CBI40086.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 54.7 bits (130), Expect(2) = 1e-07 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +1 Query: 16 DRAINIEISPKCEKLRLVSECTAESCQGNMKRLS-CRA*SIYIARC 150 DRAI+IE+ P+C+K+RLV +C +ESCQG + CRA ++ IARC Sbjct: 374 DRAIDIEVCPRCQKVRLVYDCPSESCQGKHQSAQLCRACTLCIARC 419 Score = 26.2 bits (56), Expect(2) = 1e-07 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 161 CVNDKEYEETFGLYVPC 211 C+ND +YEETF L + C Sbjct: 425 CINDCDYEETFCLDLLC 441 >ref|XP_002270874.1| PREDICTED: F-box protein SKIP14 [Vitis vinifera] Length = 480 Score = 54.7 bits (130), Expect(2) = 1e-07 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +1 Query: 16 DRAINIEISPKCEKLRLVSECTAESCQGNMKRLS-CRA*SIYIARC 150 DRAI+IE+ P+C+K+RLV +C +ESCQG + CRA ++ IARC Sbjct: 374 DRAIDIEVCPRCQKVRLVYDCPSESCQGKHQSAQLCRACTLCIARC 419 Score = 26.2 bits (56), Expect(2) = 1e-07 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 161 CVNDKEYEETFGLYVPC 211 C+ND +YEETF L + C Sbjct: 425 CINDCDYEETFCLDLLC 441 >ref|XP_003532712.1| PREDICTED: F-box protein SKIP14-like [Glycine max] Length = 451 Score = 50.1 bits (118), Expect(2) = 4e-07 Identities = 24/48 (50%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +1 Query: 16 DRAINIEISPKCEKLRLVSECTAESCQG-NMKRLSCRA*SIYIARCME 156 D+AI+IE+ P+C+ LRLV +C AESCQG CRA ++ I RC + Sbjct: 354 DQAIDIEVCPRCQNLRLVYDCPAESCQGVEHTTQVCRACTLCIPRCSQ 401 Score = 28.9 bits (63), Expect(2) = 4e-07 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 161 CVNDKEYEETFGLYVPC 211 C+ND EYEETF L + C Sbjct: 405 CINDSEYEETFCLELLC 421 >ref|XP_002876943.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297322781|gb|EFH53202.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 451 Score = 49.7 bits (117), Expect(2) = 8e-07 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Frame = +1 Query: 16 DRAINIEISPKCEKLRLVSECTAESCQGNMK-RLSCRA*SIYIARC 150 DRA++IE+ PKC+ RLV +C AE C+G K CRA S+ I RC Sbjct: 372 DRALDIEMCPKCQNSRLVYDCPAEDCKGKKKGSEECRACSLCIQRC 417 Score = 28.1 bits (61), Expect(2) = 8e-07 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 Query: 161 CVNDKEYEETFGLYVPC 211 C+ND EYEETF L C Sbjct: 423 CINDSEYEETFCLEFLC 439