BLASTX nr result
ID: Cimicifuga21_contig00035952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035952 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524101.1| PREDICTED: pentatricopeptide repeat-containi... 130 8e-29 ref|XP_002279974.1| PREDICTED: pentatricopeptide repeat-containi... 128 2e-28 emb|CBI37724.3| unnamed protein product [Vitis vinifera] 128 2e-28 ref|XP_004139977.1| PREDICTED: pentatricopeptide repeat-containi... 126 2e-27 ref|XP_002328140.1| predicted protein [Populus trichocarpa] gi|2... 126 2e-27 >ref|XP_003524101.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Glycine max] Length = 854 Score = 130 bits (328), Expect(2) = 8e-29 Identities = 55/78 (70%), Positives = 67/78 (85%) Frame = +3 Query: 9 EGRLTPLRYHNEKLAIVFGLMSLPREKPVRIMKNLRICGDCHTLAKLVSKIEDRYIVIRD 188 E R LRYH+EKLAIVFG+MS P+EK +RI KNL+ICGDCH AKL++++E R+IVIRD Sbjct: 777 EQREDSLRYHSEKLAIVFGIMSFPKEKTIRIWKNLKICGDCHKFAKLIAELEQRHIVIRD 836 Query: 189 PVRYHHFKDGTCSCGDYW 242 P+RYHHF+DG CSCGDYW Sbjct: 837 PIRYHHFQDGVCSCGDYW 854 Score = 21.2 bits (43), Expect(2) = 8e-29 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 1 GEQKEDSRRY 30 GEQ+EDS RY Sbjct: 776 GEQREDSLRY 785 >ref|XP_002279974.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Vitis vinifera] Length = 623 Score = 128 bits (321), Expect(2) = 2e-28 Identities = 56/72 (77%), Positives = 64/72 (88%) Frame = +3 Query: 27 LRYHNEKLAIVFGLMSLPREKPVRIMKNLRICGDCHTLAKLVSKIEDRYIVIRDPVRYHH 206 LRYH+EKLAI+FGLM+L REK VRI KNLRICGDCH AK+VS++E R IVIRDP+RYHH Sbjct: 552 LRYHSEKLAIMFGLMNLSREKTVRIRKNLRICGDCHVFAKVVSRMEHRSIVIRDPIRYHH 611 Query: 207 FKDGTCSCGDYW 242 F+DG CSCGDYW Sbjct: 612 FQDGVCSCGDYW 623 Score = 22.3 bits (46), Expect(2) = 2e-28 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 1 GEQKEDSRRY 30 GEQKEDS RY Sbjct: 545 GEQKEDSLRY 554 >emb|CBI37724.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 128 bits (321), Expect(2) = 2e-28 Identities = 56/72 (77%), Positives = 64/72 (88%) Frame = +3 Query: 27 LRYHNEKLAIVFGLMSLPREKPVRIMKNLRICGDCHTLAKLVSKIEDRYIVIRDPVRYHH 206 LRYH+EKLAI+FGLM+L REK VRI KNLRICGDCH AK+VS++E R IVIRDP+RYHH Sbjct: 268 LRYHSEKLAIMFGLMNLSREKTVRIRKNLRICGDCHVFAKVVSRMEHRSIVIRDPIRYHH 327 Query: 207 FKDGTCSCGDYW 242 F+DG CSCGDYW Sbjct: 328 FQDGVCSCGDYW 339 Score = 22.3 bits (46), Expect(2) = 2e-28 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 1 GEQKEDSRRY 30 GEQKEDS RY Sbjct: 261 GEQKEDSLRY 270 >ref|XP_004139977.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cucumis sativus] gi|449475689|ref|XP_004154524.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cucumis sativus] Length = 586 Score = 126 bits (316), Expect = 2e-27 Identities = 54/72 (75%), Positives = 63/72 (87%) Frame = +3 Query: 27 LRYHNEKLAIVFGLMSLPREKPVRIMKNLRICGDCHTLAKLVSKIEDRYIVIRDPVRYHH 206 L+YH+EKLAIVFGLMSLP +K + I KNLRICGDCH AKLVS++E+R IVIRDP+RYHH Sbjct: 515 LQYHSEKLAIVFGLMSLPNQKTIHIRKNLRICGDCHIFAKLVSQLENRVIVIRDPIRYHH 574 Query: 207 FKDGTCSCGDYW 242 F+ G CSCGDYW Sbjct: 575 FRGGVCSCGDYW 586 >ref|XP_002328140.1| predicted protein [Populus trichocarpa] gi|222837655|gb|EEE76020.1| predicted protein [Populus trichocarpa] Length = 534 Score = 126 bits (316), Expect = 2e-27 Identities = 55/72 (76%), Positives = 63/72 (87%) Frame = +3 Query: 27 LRYHNEKLAIVFGLMSLPREKPVRIMKNLRICGDCHTLAKLVSKIEDRYIVIRDPVRYHH 206 LRYH+EKLAIVFGLMSLPR + +RI KNLRICGDCH KL++K+E R IVIRDPVRYHH Sbjct: 463 LRYHSEKLAIVFGLMSLPRGQTIRIRKNLRICGDCHLFTKLLAKMEQRIIVIRDPVRYHH 522 Query: 207 FKDGTCSCGDYW 242 F+DG CSCGD+W Sbjct: 523 FQDGLCSCGDFW 534