BLASTX nr result
ID: Cimicifuga21_contig00035729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035729 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314843.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|XP_003592608.1| Wall-associated kinase [Medicago truncatula]... 72 6e-11 ref|XP_002314841.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 gb|ACJ85050.1| unknown [Medicago truncatula] 72 6e-11 ref|XP_002527019.1| hypothetical protein RCOM_1310780 [Ricinus c... 71 8e-11 >ref|XP_002314843.1| predicted protein [Populus trichocarpa] gi|222863883|gb|EEF01014.1| predicted protein [Populus trichocarpa] Length = 261 Score = 73.6 bits (179), Expect = 2e-11 Identities = 29/55 (52%), Positives = 35/55 (63%) Frame = -3 Query: 211 LLNKGFHLKWIASTCDDCTQSGGRCGFDYELYKFMCFCTDRPHHRRCGSSGKFCF 47 +L +GF L W AS C DC +SGG+CGFD Y F CFC DRPH +C S F + Sbjct: 207 MLERGFVLNWTASNCSDCEESGGKCGFDTATYDFKCFCPDRPHTWQCNSGESFYY 261 >ref|XP_003592608.1| Wall-associated kinase [Medicago truncatula] gi|355481656|gb|AES62859.1| Wall-associated kinase [Medicago truncatula] Length = 292 Score = 71.6 bits (174), Expect = 6e-11 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 220 VVDLLNKGFHLKWIASTCDDCTQSGGRCGFDYELYKFMCFCTDRPHHRRC 71 + + L GF L WIAS C++C +GGRCGFD ++Y F C+CTDR H +C Sbjct: 207 IEESLRNGFRLNWIASDCNECNSTGGRCGFDKDVYNFKCYCTDRVHSAKC 256 >ref|XP_002314841.1| predicted protein [Populus trichocarpa] gi|222863881|gb|EEF01012.1| predicted protein [Populus trichocarpa] Length = 264 Score = 71.6 bits (174), Expect = 6e-11 Identities = 29/50 (58%), Positives = 34/50 (68%) Frame = -3 Query: 211 LLNKGFHLKWIASTCDDCTQSGGRCGFDYELYKFMCFCTDRPHHRRCGSS 62 LL +GF L W AS C C +SGG+CGFD Y F CFC DRPH +RC S+ Sbjct: 209 LLERGFVLNWTASDCSICEESGGKCGFDTATYHFQCFCPDRPHAKRCYSA 258 >gb|ACJ85050.1| unknown [Medicago truncatula] Length = 161 Score = 71.6 bits (174), Expect = 6e-11 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 220 VVDLLNKGFHLKWIASTCDDCTQSGGRCGFDYELYKFMCFCTDRPHHRRC 71 + + L GF L WIAS C++C +GGRCGFD ++Y F C+CTDR H +C Sbjct: 76 IEESLRNGFRLNWIASDCNECNSTGGRCGFDKDVYNFKCYCTDRVHSAKC 125 >ref|XP_002527019.1| hypothetical protein RCOM_1310780 [Ricinus communis] gi|223533654|gb|EEF35391.1| hypothetical protein RCOM_1310780 [Ricinus communis] Length = 267 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = -3 Query: 229 TDFVVDLLNKGFHLKWIASTCDDCTQSGGRCGFDYELYKFMCFCTDRPHHRRCGSSGKFC 50 TD + +L +GF L WIAS C C SGG+CGFD Y F CFC DRPH C +G+F Sbjct: 203 TDGLDRMLERGFVLNWIASNCSICENSGGKCGFDDATYHFKCFCPDRPHTSNC-ITGEFS 261 Query: 49 F 47 F Sbjct: 262 F 262