BLASTX nr result
ID: Cimicifuga21_contig00035722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035722 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263743.1| PREDICTED: CDT1-like protein a, chloroplasti... 59 3e-07 emb|CBI37094.3| unnamed protein product [Vitis vinifera] 59 3e-07 >ref|XP_002263743.1| PREDICTED: CDT1-like protein a, chloroplastic-like [Vitis vinifera] Length = 646 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 302 ELVPDWIQEKVASSGDLLLCINKHSCPDSVRRRLTEA 192 ELVP+WI EK+ASSGDLLLCI K S P+S+R+RL EA Sbjct: 609 ELVPEWISEKLASSGDLLLCIKKTSSPESIRQRLMEA 645 >emb|CBI37094.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 302 ELVPDWIQEKVASSGDLLLCINKHSCPDSVRRRLTEA 192 ELVP+WI EK+ASSGDLLLCI K S P+S+R+RL EA Sbjct: 581 ELVPEWISEKLASSGDLLLCIKKTSSPESIRQRLMEA 617