BLASTX nr result
ID: Cimicifuga21_contig00035715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035715 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264260.1| PREDICTED: DNA excision repair protein ERCC-... 59 4e-07 >ref|XP_002264260.1| PREDICTED: DNA excision repair protein ERCC-6-like [Vitis vinifera] gi|296088517|emb|CBI37508.3| unnamed protein product [Vitis vinifera] Length = 1043 Score = 58.9 bits (141), Expect = 4e-07 Identities = 42/106 (39%), Positives = 54/106 (50%), Gaps = 29/106 (27%) Frame = -3 Query: 301 MAEKKKPLSLNERHRLL------SASHNRAARAPS----------------NLPEEENHQ 188 MAEKKK +SLNERH L AS ++ + PS + P+E + Sbjct: 1 MAEKKKAMSLNERHNRLLQDLSAQASKHKPEQQPSAQNHALLSFSTISEFHSPPDEAKEE 60 Query: 187 PRPLKVKVEGRRRLFKASSSIDDATLD------EPSFG-IMDFDSP 71 +P+KVK++GRRRL K SS+ DD EP F I DFDSP Sbjct: 61 EKPVKVKLQGRRRLCKLSSNDDDENTKTGDGFYEPKFSEISDFDSP 106