BLASTX nr result
ID: Cimicifuga21_contig00035631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035631 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282505.1| PREDICTED: uncharacterized protein LOC100262... 57 2e-06 ref|XP_002523586.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002282505.1| PREDICTED: uncharacterized protein LOC100262755 [Vitis vinifera] Length = 397 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/59 (49%), Positives = 37/59 (62%) Frame = -1 Query: 179 MVDVDRRMTGFTPAHVAGXXXXXXXXXXXXXXXXAMPLRKGLHSFSSLAEQVIIHLRKS 3 MVDVDRRMTG PAH+AG A+P+R GL SF++LA++VI HL+ S Sbjct: 1 MVDVDRRMTGLNPAHIAGLRRLSARAAAPSTVSTALPVRNGLISFTTLADKVIAHLQNS 59 >ref|XP_002523586.1| conserved hypothetical protein [Ricinus communis] gi|223537148|gb|EEF38781.1| conserved hypothetical protein [Ricinus communis] Length = 398 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/59 (52%), Positives = 35/59 (59%) Frame = -1 Query: 179 MVDVDRRMTGFTPAHVAGXXXXXXXXXXXXXXXXAMPLRKGLHSFSSLAEQVIIHLRKS 3 MVDVDRRMTG PAH+AG P+R GL SFSSLA++VI HLR S Sbjct: 1 MVDVDRRMTGLNPAHIAG----LRRLSARAAAPSTAPVRNGLVSFSSLADKVITHLRNS 55