BLASTX nr result
ID: Cimicifuga21_contig00035140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035140 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64093.1| hypothetical protein VITISV_016055 [Vitis vinifera] 62 5e-08 ref|XP_002530849.1| protein binding protein, putative [Ricinus c... 59 3e-07 ref|XP_002312093.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 >emb|CAN64093.1| hypothetical protein VITISV_016055 [Vitis vinifera] Length = 252 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/67 (47%), Positives = 39/67 (58%) Frame = -2 Query: 202 YCDACGKIASGFVYHGVQKGTPYNFHPCCAVLLPYLHIEGMELQLQKRLTWPSKCFWCGN 23 YCDACGK GFVYH +KG ++ HPCC L L I+G++ L R T SKC WC Sbjct: 90 YCDACGKPIHGFVYHCKEKG--WDLHPCCRNLTNELDIDGIKFHL--RGTVSSKCIWCNQ 145 Query: 22 SDIWGKV 2 + G V Sbjct: 146 RNPPGSV 152 >ref|XP_002530849.1| protein binding protein, putative [Ricinus communis] gi|223529573|gb|EEF31523.1| protein binding protein, putative [Ricinus communis] Length = 233 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/67 (43%), Positives = 41/67 (61%) Frame = -2 Query: 202 YCDACGKIASGFVYHGVQKGTPYNFHPCCAVLLPYLHIEGMELQLQKRLTWPSKCFWCGN 23 YCDACGK G+VY K P++ HPCC L L +G+ + L+++L PSKC CG+ Sbjct: 83 YCDACGKDILGYVYQCNHK-RPFDLHPCCVKLQRTLSADGVTIHLKEKL--PSKCLKCGS 139 Query: 22 SDIWGKV 2 +I +V Sbjct: 140 KEIAKRV 146 >ref|XP_002312093.1| predicted protein [Populus trichocarpa] gi|222851913|gb|EEE89460.1| predicted protein [Populus trichocarpa] Length = 248 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = -2 Query: 202 YCDACGKIASGFVYHGVQKGTPYNFHPCCAVLLPYLHIE-GMELQLQKRLTWPSKCFWCG 26 YCDACG+ SGFVY K P++FHP C L L E G+ +QL+K+L PSKC +CG Sbjct: 83 YCDACGEDVSGFVYQCKHK-NPHDFHPRCLKLPRTLTTEDGLMIQLRKKL--PSKCLYCG 139 Query: 25 NSDIWGKV 2 + + ++ Sbjct: 140 SKETSNRI 147