BLASTX nr result
ID: Cimicifuga21_contig00035124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035124 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282697.1| PREDICTED: uncharacterized exonuclease domai... 108 3e-22 ref|XP_002523270.1| exonuclease, putative [Ricinus communis] gi|... 99 5e-19 dbj|BAB02568.1| unnamed protein product [Arabidopsis thaliana] 96 2e-18 ref|NP_566502.1| uncharacterized exonuclease domain-containing p... 96 2e-18 ref|XP_002885072.1| hypothetical protein ARALYDRAFT_318289 [Arab... 93 2e-17 >ref|XP_002282697.1| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 [Vitis vinifera] Length = 319 Score = 108 bits (271), Expect = 3e-22 Identities = 57/108 (52%), Positives = 71/108 (65%), Gaps = 2/108 (1%) Frame = +1 Query: 166 TLSSNI--MRSPSLSLFHPRRLFNVHATFSTHQXXXXXXXXXIVTKTPRWKPLCLYYTHG 339 +LSS I + SPS SL P R F + A+ ST + RW+P+CLYYT G Sbjct: 13 SLSSLIPYVSSPS-SLSPPVRTFTLSASISTPHPSPPSLLTASPKASDRWRPMCLYYTQG 71 Query: 340 KCTKMDDPAHLATFNHDCSAGLKVDSGEFKNLQSQHFDYLLVLDLEGK 483 KCTKMDDP HL TFNH+CS L+V++ F++LQSQH D+ LVLDLEGK Sbjct: 72 KCTKMDDPTHLETFNHNCSRELQVNAANFQHLQSQHLDFFLVLDLEGK 119 >ref|XP_002523270.1| exonuclease, putative [Ricinus communis] gi|223537483|gb|EEF39109.1| exonuclease, putative [Ricinus communis] Length = 329 Score = 98.6 bits (244), Expect = 5e-19 Identities = 41/64 (64%), Positives = 49/64 (76%) Frame = +1 Query: 292 TKTPRWKPLCLYYTHGKCTKMDDPAHLATFNHDCSAGLKVDSGEFKNLQSQHFDYLLVLD 471 T T RWKP+CLY+THGKCTKMDDP HL FNHDCS L V++ +FK + Q F++ LV D Sbjct: 65 TNTYRWKPMCLYFTHGKCTKMDDPTHLEVFNHDCSRDLPVNAADFKRKRPQDFEFFLVFD 124 Query: 472 LEGK 483 LEGK Sbjct: 125 LEGK 128 >dbj|BAB02568.1| unnamed protein product [Arabidopsis thaliana] Length = 1161 Score = 96.3 bits (238), Expect = 2e-18 Identities = 39/64 (60%), Positives = 51/64 (79%) Frame = +1 Query: 292 TKTPRWKPLCLYYTHGKCTKMDDPAHLATFNHDCSAGLKVDSGEFKNLQSQHFDYLLVLD 471 ++ RW+P+CLYYTHGKCTKMDDPAHL FNHDCS L+V + + + +SQ F++ LV+D Sbjct: 74 SENARWRPMCLYYTHGKCTKMDDPAHLEIFNHDCSKELRVAAADLERKKSQEFNFFLVID 133 Query: 472 LEGK 483 LEGK Sbjct: 134 LEGK 137 >ref|NP_566502.1| uncharacterized exonuclease domain-containing protein [Arabidopsis thaliana] gi|75331425|sp|Q8W566.1|Y3514_ARATH RecName: Full=Uncharacterized exonuclease domain-containing protein At3g15140 gi|16930517|gb|AAL31944.1|AF419612_1 AT3g15140/F4B12_5 [Arabidopsis thaliana] gi|19310525|gb|AAL84996.1| AT3g15140/F4B12_5 [Arabidopsis thaliana] gi|332642103|gb|AEE75624.1| uncharacterized exonuclease domain-containing protein [Arabidopsis thaliana] Length = 337 Score = 96.3 bits (238), Expect = 2e-18 Identities = 39/64 (60%), Positives = 51/64 (79%) Frame = +1 Query: 292 TKTPRWKPLCLYYTHGKCTKMDDPAHLATFNHDCSAGLKVDSGEFKNLQSQHFDYLLVLD 471 ++ RW+P+CLYYTHGKCTKMDDPAHL FNHDCS L+V + + + +SQ F++ LV+D Sbjct: 74 SENARWRPMCLYYTHGKCTKMDDPAHLEIFNHDCSKELRVAAADLERKKSQEFNFFLVID 133 Query: 472 LEGK 483 LEGK Sbjct: 134 LEGK 137 >ref|XP_002885072.1| hypothetical protein ARALYDRAFT_318289 [Arabidopsis lyrata subsp. lyrata] gi|297330912|gb|EFH61331.1| hypothetical protein ARALYDRAFT_318289 [Arabidopsis lyrata subsp. lyrata] Length = 1134 Score = 93.2 bits (230), Expect = 2e-17 Identities = 39/64 (60%), Positives = 49/64 (76%) Frame = +1 Query: 292 TKTPRWKPLCLYYTHGKCTKMDDPAHLATFNHDCSAGLKVDSGEFKNLQSQHFDYLLVLD 471 ++ RW+P+CLYYTHGKCTKMDDPAHL FNHDCS L V + + +SQ F++ LV+D Sbjct: 71 SENARWRPMCLYYTHGKCTKMDDPAHLEIFNHDCSKELPVAATDLGRKKSQEFNFFLVID 130 Query: 472 LEGK 483 LEGK Sbjct: 131 LEGK 134