BLASTX nr result
ID: Cimicifuga21_contig00034963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034963 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302515.1| predicted protein [Populus trichocarpa] gi|1... 78 8e-13 ref|XP_002326819.1| predicted protein [Populus trichocarpa] gi|1... 78 8e-13 ref|XP_003605285.1| Protein transport protein Sec61 beta subunit... 76 2e-12 ref|XP_004133771.1| PREDICTED: protein transport protein Sec61 s... 75 4e-12 gb|AFK48843.1| unknown [Lotus japonicus] 75 4e-12 >ref|XP_002302515.1| predicted protein [Populus trichocarpa] gi|118481855|gb|ABK92864.1| unknown [Populus trichocarpa] gi|222844241|gb|EEE81788.1| predicted protein [Populus trichocarpa] Length = 84 Score = 77.8 bits (190), Expect = 8e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 312 FYTDDAPGLKISPNVVLTMSIGFIAFVAVLHVVGKLYLV*R 190 FYTDDAPGLKISPNVVL MSIGFIAFVA+LHVVGKLYLV R Sbjct: 42 FYTDDAPGLKISPNVVLVMSIGFIAFVAILHVVGKLYLVRR 82 >ref|XP_002326819.1| predicted protein [Populus trichocarpa] gi|118486407|gb|ABK95043.1| unknown [Populus trichocarpa] gi|222835134|gb|EEE73569.1| predicted protein [Populus trichocarpa] Length = 82 Score = 77.8 bits (190), Expect = 8e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 312 FYTDDAPGLKISPNVVLTMSIGFIAFVAVLHVVGKLYLV*R 190 FYTDDAPGLKISPNVVL MSIGFIAFVA+LHVVGKLYLV R Sbjct: 40 FYTDDAPGLKISPNVVLVMSIGFIAFVAILHVVGKLYLVRR 80 >ref|XP_003605285.1| Protein transport protein Sec61 beta subunit [Medicago truncatula] gi|355506340|gb|AES87482.1| Protein transport protein Sec61 beta subunit [Medicago truncatula] gi|388516919|gb|AFK46521.1| unknown [Medicago truncatula] gi|388518729|gb|AFK47426.1| unknown [Medicago truncatula] Length = 80 Score = 76.3 bits (186), Expect = 2e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 312 FYTDDAPGLKISPNVVLTMSIGFIAFVAVLHVVGKLYL 199 FYTDDAPGLKISPNVVL MSIGFIAFVAVLHVVGKLYL Sbjct: 40 FYTDDAPGLKISPNVVLVMSIGFIAFVAVLHVVGKLYL 77 >ref|XP_004133771.1| PREDICTED: protein transport protein Sec61 subunit beta-like isoform 1 [Cucumis sativus] gi|449431968|ref|XP_004133772.1| PREDICTED: protein transport protein Sec61 subunit beta-like isoform 2 [Cucumis sativus] gi|449431970|ref|XP_004133773.1| PREDICTED: protein transport protein Sec61 subunit beta-like isoform 3 [Cucumis sativus] Length = 82 Score = 75.5 bits (184), Expect = 4e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 312 FYTDDAPGLKISPNVVLTMSIGFIAFVAVLHVVGKLYLV*R 190 FYTDDAPGLKISPNVVL MSIGFIAFVAVLHV+GKLY V R Sbjct: 40 FYTDDAPGLKISPNVVLVMSIGFIAFVAVLHVMGKLYFVRR 80 >gb|AFK48843.1| unknown [Lotus japonicus] Length = 82 Score = 75.5 bits (184), Expect = 4e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 312 FYTDDAPGLKISPNVVLTMSIGFIAFVAVLHVVGKLYLV*R 190 FYTDDAPGLKISPNVVL MSIGFIAFVAVLHV+GKLY V R Sbjct: 40 FYTDDAPGLKISPNVVLVMSIGFIAFVAVLHVMGKLYFVRR 80