BLASTX nr result
ID: Cimicifuga21_contig00034812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034812 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_04532939.1| leucine rich protein [Escherichia sp. 3_2_53F... 77 1e-12 emb|CCG94050.1| hypothetical protein MARHY0556 [Marinobacter hyd... 75 4e-12 ref|ZP_06187877.1| conserved hypothetical protein [Legionella lo... 47 4e-06 gb|ADI21113.1| hypothetical protein [uncultured gamma proteobact... 55 8e-06 >ref|ZP_04532939.1| leucine rich protein [Escherichia sp. 3_2_53FAA] gi|226903372|gb|EEH89631.1| leucine rich protein [Escherichia sp. 3_2_53FAA] Length = 56 Score = 77.0 bits (188), Expect = 1e-12 Identities = 38/56 (67%), Positives = 41/56 (73%) Frame = -2 Query: 217 LPKIPAYHLKLGQPTPSWPSLLRPSIAITRSTGILTCFPSTTLFSLALGTD*PCVD 50 +P PAY LK GQP+P SLLRP A+T STGILTCFPSTT F LALG D PC D Sbjct: 1 MPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPSTTPFGLALGVDSPCPD 56 >emb|CCG94050.1| hypothetical protein MARHY0556 [Marinobacter hydrocarbonoclasticus ATCC 49840] Length = 60 Score = 75.5 bits (184), Expect = 4e-12 Identities = 39/58 (67%), Positives = 41/58 (70%) Frame = -2 Query: 223 PDLPKIPAYHLKLGQPTPSWPSLLRPSIAITRSTGILTCFPSTTLFSLALGTD*PCVD 50 PDLPK Y LK GQP+P PSLLR SIA + TGILT FPSTT F LALG D PC D Sbjct: 3 PDLPKSTPYMLKPGQPSPGSPSLLRLSIAAIQGTGILTRFPSTTPFGLALGADSPCAD 60 >ref|ZP_06187877.1| conserved hypothetical protein [Legionella longbeachae D-4968] gi|269987560|gb|EEZ93815.1| conserved hypothetical protein [Legionella longbeachae D-4968] Length = 157 Score = 46.6 bits (109), Expect(2) = 4e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = -2 Query: 148 PSIAITRSTGILTCFPSTTLFSLALGTD*PCVD 50 P+ + +S GILT FPSTTLFSLALG D PC D Sbjct: 125 PTSPLIKSPGILTWFPSTTLFSLALGADSPCSD 157 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 222 RIYLRFQPTTLNLDNQRQAGLAFSVPPS 139 RI L PT DNQR A LAF VP S Sbjct: 100 RICLNHPPTCTYQDNQRLAHLAFFVPTS 127 >gb|ADI21113.1| hypothetical protein [uncultured gamma proteobacterium EB750_07C09] Length = 46 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/37 (75%), Positives = 28/37 (75%) Frame = +3 Query: 75 KARLKSVVDGKQVNIPVLLVIAMEGRRRLGQLGVGCP 185 KAR K VVDGK VNIPVL V AM GRRRL GVGCP Sbjct: 6 KARPKGVVDGKLVNIPVLCVTAMRGRRRLDLPGVGCP 42