BLASTX nr result
ID: Cimicifuga21_contig00034426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034426 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE57071.1| hypothetical protein OsJ_06894 [Oryza sativa Japo... 62 4e-08 ref|XP_002459817.1| hypothetical protein SORBIDRAFT_02g011180 [S... 57 2e-06 ref|XP_002468682.1| hypothetical protein SORBIDRAFT_01g050160 [S... 57 2e-06 ref|XP_002464683.1| hypothetical protein SORBIDRAFT_01g023250 [S... 57 2e-06 ref|XP_003543854.1| PREDICTED: uncharacterized protein LOC100780... 56 3e-06 >gb|EEE57071.1| hypothetical protein OsJ_06894 [Oryza sativa Japonica Group] Length = 1344 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = +1 Query: 145 CKRYYNMEWLEEVPGRVPPHQDAEISSEKDKCFKRYFVNDEER 273 CKRYY WL EVP R PH DAEIS ++KCF+RYF DE R Sbjct: 1175 CKRYYCESWLAEVPTREAPHMDAEISEMRNKCFRRYFAGDELR 1217 >ref|XP_002459817.1| hypothetical protein SORBIDRAFT_02g011180 [Sorghum bicolor] gi|241923194|gb|EER96338.1| hypothetical protein SORBIDRAFT_02g011180 [Sorghum bicolor] Length = 647 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +1 Query: 151 RYYNMEWLEEVPGRVPPHQDAEISSEKDKCFKRYFVNDEE 270 RYY+ +WLEE GRVPPH+D E+S + CFKR+F N E+ Sbjct: 443 RYYSQKWLEEGVGRVPPHKDKEVSKMRMTCFKRFFPNPED 482 >ref|XP_002468682.1| hypothetical protein SORBIDRAFT_01g050160 [Sorghum bicolor] gi|241922536|gb|EER95680.1| hypothetical protein SORBIDRAFT_01g050160 [Sorghum bicolor] Length = 647 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +1 Query: 151 RYYNMEWLEEVPGRVPPHQDAEISSEKDKCFKRYFVNDEE 270 RYY+ +WLEE GRVPPH+D E+S + CFKR+F N E+ Sbjct: 443 RYYSQKWLEEGVGRVPPHKDKEVSKMRMTCFKRFFPNPED 482 >ref|XP_002464683.1| hypothetical protein SORBIDRAFT_01g023250 [Sorghum bicolor] gi|241918537|gb|EER91681.1| hypothetical protein SORBIDRAFT_01g023250 [Sorghum bicolor] Length = 647 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +1 Query: 151 RYYNMEWLEEVPGRVPPHQDAEISSEKDKCFKRYFVNDEE 270 RYY+ +WLEE GRVPPH+D E+S + CFKR+F N E+ Sbjct: 443 RYYSQKWLEEGVGRVPPHKDKEVSKMRMTCFKRFFPNPED 482 >ref|XP_003543854.1| PREDICTED: uncharacterized protein LOC100780312 [Glycine max] Length = 557 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +1 Query: 151 RYYNMEWLEEVPGRVPPHQDAEISSEKDKCFKRYFVNDEER 273 RYY+ EWL E RVPPHQD E++ E+ KCFKR+F++ + R Sbjct: 367 RYYSHEWLSEDSNRVPPHQDMELTRERLKCFKRFFLDVDVR 407