BLASTX nr result
ID: Cimicifuga21_contig00034410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034410 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] 58 7e-07 >emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] Length = 1171 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +3 Query: 255 NGRPTCQICGKLGHYAIDCYDRMNHSYQGKIPPAKL 362 N RP CQICGK GH AIDC+ R ++SYQG+ PP L Sbjct: 270 NNRPVCQICGKSGHTAIDCFHRFDYSYQGRFPPQDL 305