BLASTX nr result
ID: Cimicifuga21_contig00034321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034321 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79175.1| hypothetical protein VITISV_001884 [Vitis vinifera] 52 3e-06 emb|CAN60058.1| hypothetical protein VITISV_039054 [Vitis vinifera] 53 5e-06 emb|CAN69597.1| hypothetical protein VITISV_038518 [Vitis vinifera] 52 6e-06 emb|CAN78598.1| hypothetical protein VITISV_001332 [Vitis vinifera] 52 6e-06 emb|CAN63881.1| hypothetical protein VITISV_039357 [Vitis vinifera] 52 6e-06 >emb|CAN79175.1| hypothetical protein VITISV_001884 [Vitis vinifera] Length = 1487 Score = 52.4 bits (124), Expect(2) = 3e-06 Identities = 22/57 (38%), Positives = 37/57 (64%) Frame = -2 Query: 171 RVTNHPIAKFISYSGISPSYCAPLVASDSIRILRSVSETLQHSSWRAAMITEMDALQ 1 R T+HPI +++Y G+SPSY A + D ++ ++ E L+ S W+ A+ E+DAL+ Sbjct: 742 RCTDHPIGNYVTYEGLSPSYRAFATSLDDTQVPNTIQEALKISEWKKAVQDEIDALE 798 Score = 23.5 bits (49), Expect(2) = 3e-06 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 248 DSVIYVPMPVDDLSLPIAQCKATRSC 171 D + +P +DD +LPIA K R C Sbjct: 719 DGEVLIPS-IDDSTLPIALRKGVRRC 743 >emb|CAN60058.1| hypothetical protein VITISV_039054 [Vitis vinifera] Length = 999 Score = 52.8 bits (125), Expect(2) = 5e-06 Identities = 22/57 (38%), Positives = 36/57 (63%) Frame = -2 Query: 171 RVTNHPIAKFISYSGISPSYCAPLVASDSIRILRSVSETLQHSSWRAAMITEMDALQ 1 R TNHPI +++Y G+SPSY A + D ++ ++ E + S W+ A+ E+DAL+ Sbjct: 524 RCTNHPIGNYVTYEGLSPSYRAFATSLDDTQVPNTIQEAFKISEWKKAVQDEIDALE 580 Score = 22.3 bits (46), Expect(2) = 5e-06 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 221 VDDLSLPIAQCKATRSC 171 +DD +LPIA K R C Sbjct: 509 IDDSTLPIALRKGVRRC 525 >emb|CAN69597.1| hypothetical protein VITISV_038518 [Vitis vinifera] Length = 1893 Score = 52.4 bits (124), Expect(2) = 6e-06 Identities = 22/57 (38%), Positives = 37/57 (64%) Frame = -2 Query: 171 RVTNHPIAKFISYSGISPSYCAPLVASDSIRILRSVSETLQHSSWRAAMITEMDALQ 1 R T+HPI +++Y G+SPSY A + D ++ ++ E L+ S W+ A+ E+DAL+ Sbjct: 1367 RCTDHPIGNYVTYEGLSPSYRAFATSLDDTQVPNTIQEALKISEWKKAVQDEIDALE 1423 Score = 22.3 bits (46), Expect(2) = 6e-06 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 221 VDDLSLPIAQCKATRSC 171 +DD +LPIA K R C Sbjct: 1352 IDDSTLPIALRKGVRRC 1368 >emb|CAN78598.1| hypothetical protein VITISV_001332 [Vitis vinifera] Length = 1701 Score = 52.4 bits (124), Expect(2) = 6e-06 Identities = 22/57 (38%), Positives = 37/57 (64%) Frame = -2 Query: 171 RVTNHPIAKFISYSGISPSYCAPLVASDSIRILRSVSETLQHSSWRAAMITEMDALQ 1 R T+HPI +++Y G+SPSY A + D ++ ++ E L+ S W+ A+ E+DAL+ Sbjct: 1187 RCTDHPIGNYVTYEGLSPSYRAFATSLDDTQVPNTIQEALKISEWKKAVQDEIDALE 1243 Score = 22.3 bits (46), Expect(2) = 6e-06 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 221 VDDLSLPIAQCKATRSC 171 +DD +LPIA K R C Sbjct: 1172 IDDSTLPIALRKGVRRC 1188 >emb|CAN63881.1| hypothetical protein VITISV_039357 [Vitis vinifera] Length = 1611 Score = 52.4 bits (124), Expect(2) = 6e-06 Identities = 22/57 (38%), Positives = 37/57 (64%) Frame = -2 Query: 171 RVTNHPIAKFISYSGISPSYCAPLVASDSIRILRSVSETLQHSSWRAAMITEMDALQ 1 R T+HPI +++Y G+SPSY A + D ++ ++ E L+ S W+ A+ E+DAL+ Sbjct: 943 RCTDHPIGNYVTYEGLSPSYRAFATSLDDTQVPNTIQEALKISEWKKAVQDEIDALE 999 Score = 22.3 bits (46), Expect(2) = 6e-06 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 221 VDDLSLPIAQCKATRSC 171 +DD +LPIA K R C Sbjct: 928 IDDSTLPIALRKGVRRC 944