BLASTX nr result
ID: Cimicifuga21_contig00034306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034306 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520135.1| voltage-dependent anion-selective channel, p... 56 3e-06 ref|XP_002312708.1| porin/voltage-dependent anion-selective chan... 56 3e-06 ref|XP_003631280.1| PREDICTED: mitochondrial outer membrane prot... 55 4e-06 ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane prot... 55 4e-06 ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein... 55 6e-06 >ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus communis] gi|223540627|gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus communis] Length = 276 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -3 Query: 310 SATIQHEWWPKPLFTVSGEVDVMAIGKSAKIGVGLA 203 SA IQHEW PK LFT+SGEVD AI KSAKIG+ LA Sbjct: 238 SALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALA 273 >ref|XP_002312708.1| porin/voltage-dependent anion-selective channel protein [Populus trichocarpa] gi|118484777|gb|ABK94257.1| unknown [Populus trichocarpa] gi|222852528|gb|EEE90075.1| porin/voltage-dependent anion-selective channel protein [Populus trichocarpa] Length = 276 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -3 Query: 310 SATIQHEWWPKPLFTVSGEVDVMAIGKSAKIGVGLA 203 SA IQHEW PK LFT+SGEVD AI KSAKIG+ LA Sbjct: 238 SALIQHEWRPKSLFTISGEVDTKAIEKSAKIGLALA 273 >ref|XP_003631280.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa isoform 2 [Vitis vinifera] Length = 247 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 310 SATIQHEWWPKPLFTVSGEVDVMAIGKSAKIGVGLA 203 SA IQHEW PK LFT+SGEVD A+ KSAKIG+ LA Sbjct: 209 SALIQHEWRPKSLFTISGEVDARAVEKSAKIGLALA 244 >ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa isoform 1 [Vitis vinifera] Length = 276 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 310 SATIQHEWWPKPLFTVSGEVDVMAIGKSAKIGVGLA 203 SA IQHEW PK LFT+SGEVD A+ KSAKIG+ LA Sbjct: 238 SALIQHEWRPKSLFTISGEVDARAVEKSAKIGLALA 273 >ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein porin-like [Glycine max] Length = 276 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 310 SATIQHEWWPKPLFTVSGEVDVMAIGKSAKIGVGLA 203 +A IQHEW PK FT+SGEVD AI KSAK+G+GLA Sbjct: 238 NALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLA 273