BLASTX nr result
ID: Cimicifuga21_contig00034295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034295 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA49434.1| cytochrome P-450 [Catharanthus roseus] 79 3e-13 ref|XP_003529672.1| PREDICTED: cytochrome P450 71D8-like [Glycin... 76 2e-12 ref|XP_003610581.1| Cytochrome P450 [Medicago truncatula] gi|355... 75 4e-12 ref|XP_002522762.1| cytochrome P450, putative [Ricinus communis]... 73 2e-11 ref|XP_002522900.1| cytochrome P450, putative [Ricinus communis]... 72 5e-11 >emb|CAA49434.1| cytochrome P-450 [Catharanthus roseus] Length = 65 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +1 Query: 1 PLAQLLYRFDWKLPNGAKPDELDMNERFGATVGRKSNLYLIPTPYCP*YIE 153 P+AQLLY FDWKLPN AKP+ELDMNE+FG TVGR+++L LI PYC +++ Sbjct: 15 PIAQLLYHFDWKLPNDAKPEELDMNEKFGLTVGRENDLELIAIPYCHSFLQ 65 >ref|XP_003529672.1| PREDICTED: cytochrome P450 71D8-like [Glycine max] Length = 511 Score = 76.3 bits (186), Expect = 2e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +1 Query: 1 PLAQLLYRFDWKLPNGAKPDELDMNERFGATVGRKSNLYLIPTPY 135 PL LLY FDW+LPNG KP++LDM E FGA VGRK+NLYL+P+PY Sbjct: 457 PLVALLYHFDWELPNGMKPEDLDMTEGFGAAVGRKNNLYLMPSPY 501 >ref|XP_003610581.1| Cytochrome P450 [Medicago truncatula] gi|355511636|gb|AES92778.1| Cytochrome P450 [Medicago truncatula] Length = 389 Score = 75.5 bits (184), Expect = 4e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +1 Query: 1 PLAQLLYRFDWKLPNGAKPDELDMNERFGATVGRKSNLYLIPTPY 135 PLA LLY F+W+LPNG KP++LDM E FGA V R++NLYLIPTPY Sbjct: 344 PLAALLYHFNWELPNGMKPEDLDMTEAFGAVVARRNNLYLIPTPY 388 >ref|XP_002522762.1| cytochrome P450, putative [Ricinus communis] gi|223538000|gb|EEF39613.1| cytochrome P450, putative [Ricinus communis] Length = 507 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = +1 Query: 1 PLAQLLYRFDWKLPNGAKPDELDMNERFGATVGRKSNLYLIPTPYCP 141 PLAQLLY FDWKLP G KP+ DM E FGA V RKS+LY+IP P+ P Sbjct: 457 PLAQLLYHFDWKLPTGVKPETFDMTEDFGAVVKRKSDLYVIPMPFLP 503 >ref|XP_002522900.1| cytochrome P450, putative [Ricinus communis] gi|223537885|gb|EEF39500.1| cytochrome P450, putative [Ricinus communis] Length = 221 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +1 Query: 1 PLAQLLYRFDWKLPNGAKPDELDMNERFGATVGRKSNLYLIPTPYCP 141 PLAQLLY FDWKLP+G P++LDM E FGAT+ RK+ L++IPT Y P Sbjct: 161 PLAQLLYHFDWKLPDGVAPEDLDMTETFGATITRKNKLHVIPTRYQP 207