BLASTX nr result
ID: Cimicifuga21_contig00034081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034081 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinif... 72 8e-22 emb|CBI19611.3| unnamed protein product [Vitis vinifera] 67 7e-20 ref|XP_002282014.1| PREDICTED: cytochrome P450 82A3-like [Vitis ... 67 7e-20 emb|CBI40977.3| unnamed protein product [Vitis vinifera] 68 3e-19 ref|XP_002268915.1| PREDICTED: cytochrome P450 82C4 [Vitis vinif... 68 3e-19 >ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinifera] Length = 731 Score = 72.0 bits (175), Expect(2) = 8e-22 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 378 RGQHFELIPFGSGRRSCPGISFGLQVIHLTLACLLQGFDFET 253 +GQHFELIPFGSGRR CPGISFGLQ + TLA L+QGF+F T Sbjct: 654 KGQHFELIPFGSGRRICPGISFGLQFMQFTLASLIQGFEFAT 695 Score = 56.6 bits (135), Expect(2) = 8e-22 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 152 VDMTESVGLTNLKATPLEVLIAPRLTSNLY 63 VDMTES+GLTNLKATPLEVL+APRL+S+LY Sbjct: 701 VDMTESIGLTNLKATPLEVLVAPRLSSDLY 730 >emb|CBI19611.3| unnamed protein product [Vitis vinifera] Length = 929 Score = 66.6 bits (161), Expect(2) = 7e-20 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 378 RGQHFELIPFGSGRRSCPGISFGLQVIHLTLACLLQGFDFET 253 RG HFELIPFGSGRR CPG+S LQ + TLA L+QGF+F T Sbjct: 443 RGMHFELIPFGSGRRICPGVSLALQFLQFTLASLIQGFEFAT 484 Score = 55.5 bits (132), Expect(2) = 7e-20 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 152 VDMTESVGLTNLKATPLEVLIAPRLTSNLY 63 VDMTES+GLTNLKATPL+VL+ PRL+SNLY Sbjct: 490 VDMTESIGLTNLKATPLDVLLTPRLSSNLY 519 >ref|XP_002282014.1| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera] Length = 554 Score = 66.6 bits (161), Expect(2) = 7e-20 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 378 RGQHFELIPFGSGRRSCPGISFGLQVIHLTLACLLQGFDFET 253 RG HFELIPFGSGRR CPG+S LQ + TLA L+QGF+F T Sbjct: 477 RGMHFELIPFGSGRRICPGVSLALQFLQFTLASLIQGFEFAT 518 Score = 55.5 bits (132), Expect(2) = 7e-20 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 152 VDMTESVGLTNLKATPLEVLIAPRLTSNLY 63 VDMTES+GLTNLKATPL+VL+ PRL+SNLY Sbjct: 524 VDMTESIGLTNLKATPLDVLLTPRLSSNLY 553 >emb|CBI40977.3| unnamed protein product [Vitis vinifera] Length = 543 Score = 67.8 bits (164), Expect(2) = 3e-19 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 378 RGQHFELIPFGSGRRSCPGISFGLQVIHLTLACLLQGFDFETP 250 RGQHFELIPFGSGRRSCPGIS LQV+H LA LL ++ P Sbjct: 465 RGQHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKP 507 Score = 52.0 bits (123), Expect(2) = 3e-19 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 152 VDMTESVGLTNLKATPLEVLIAPRLTSNLY 63 VDMTES+GLTNLKATPLEVL++PRL + LY Sbjct: 512 VDMTESLGLTNLKATPLEVLLSPRLKAELY 541 >ref|XP_002268915.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|147794787|emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera] Length = 528 Score = 67.8 bits (164), Expect(2) = 3e-19 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 378 RGQHFELIPFGSGRRSCPGISFGLQVIHLTLACLLQGFDFETP 250 RGQHFELIPFGSGRRSCPGIS LQV+H LA LL ++ P Sbjct: 450 RGQHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKP 492 Score = 52.0 bits (123), Expect(2) = 3e-19 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 152 VDMTESVGLTNLKATPLEVLIAPRLTSNLY 63 VDMTES+GLTNLKATPLEVL++PRL + LY Sbjct: 497 VDMTESLGLTNLKATPLEVLLSPRLKAELY 526