BLASTX nr result
ID: Cimicifuga21_contig00034072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034072 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003620516.1| Ethylene-responsive transciptional coactivat... 81 1e-13 ref|XP_003620515.1| Ethylene-responsive transciptional coactivat... 81 1e-13 ref|XP_003620514.1| Ethylene-responsive transciptional coactivat... 81 1e-13 ref|XP_002514331.1| Multiprotein-bridging factor, putative [Rici... 81 1e-13 ref|XP_002324409.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 >ref|XP_003620516.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] gi|355495531|gb|AES76734.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] Length = 148 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -3 Query: 165 MPTRSAGPMSQDWEPVVLRKSKPKKQELSDPKAVNQALRSGAAISTVKKTAAGTN 1 MPTR+ G + QDWEPVVL K+KPK Q+L +PKAVNQALR+GA + TVKK AG+N Sbjct: 1 MPTRTVGTIKQDWEPVVLHKTKPKAQDLRNPKAVNQALRTGAEVLTVKKPTAGSN 55 >ref|XP_003620515.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] gi|355495530|gb|AES76733.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] Length = 146 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -3 Query: 165 MPTRSAGPMSQDWEPVVLRKSKPKKQELSDPKAVNQALRSGAAISTVKKTAAGTN 1 MPTR+ G + QDWEPVVL K+KPK Q+L +PKAVNQALR+GA + TVKK AG+N Sbjct: 1 MPTRTVGTIKQDWEPVVLHKTKPKAQDLRNPKAVNQALRTGAEVLTVKKPTAGSN 55 >ref|XP_003620514.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] gi|355495529|gb|AES76732.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] Length = 176 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -3 Query: 165 MPTRSAGPMSQDWEPVVLRKSKPKKQELSDPKAVNQALRSGAAISTVKKTAAGTN 1 MPTR+ G + QDWEPVVL K+KPK Q+L +PKAVNQALR+GA + TVKK AG+N Sbjct: 1 MPTRTVGTIKQDWEPVVLHKTKPKAQDLRNPKAVNQALRTGAEVLTVKKPTAGSN 55 >ref|XP_002514331.1| Multiprotein-bridging factor, putative [Ricinus communis] gi|223546787|gb|EEF48285.1| Multiprotein-bridging factor, putative [Ricinus communis] Length = 146 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -3 Query: 165 MPTRSAGPMSQDWEPVVLRKSKPKKQELSDPKAVNQALRSGAAISTVKKTAAGTN 1 MP+RS G +SQDW+PVVLRKSK K Q+L DPKAVNQALRSGA + T+KK G N Sbjct: 1 MPSRSTGVISQDWDPVVLRKSKTKAQDLRDPKAVNQALRSGAPVQTIKKFDGGAN 55 >ref|XP_002324409.1| predicted protein [Populus trichocarpa] gi|222865843|gb|EEF02974.1| predicted protein [Populus trichocarpa] Length = 145 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/55 (65%), Positives = 44/55 (80%) Frame = -3 Query: 165 MPTRSAGPMSQDWEPVVLRKSKPKKQELSDPKAVNQALRSGAAISTVKKTAAGTN 1 MP+RSAG + QDWEPVV+ K+KPK Q+L DPK VN ALRSGA + T+KK AG+N Sbjct: 1 MPSRSAGVIKQDWEPVVMHKAKPKSQDLRDPKVVNHALRSGAPVQTIKKFDAGSN 55