BLASTX nr result
ID: Cimicifuga21_contig00034046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034046 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549820.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-14 ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 81 1e-13 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 >ref|XP_003549820.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/64 (60%), Positives = 55/64 (85%) Frame = +1 Query: 4 HKNLYFSSQPDSIAELVATNEWSEGLEEKLGKSHSTLSHETVLYVLKKLERNPLKALDFF 183 H+NLYFSS+P+SI ELV T++WS+GLE++L K + +++HETV+YVLK++E NP KA FF Sbjct: 59 HQNLYFSSKPNSIVELVLTSDWSKGLEQELEKCYPSMTHETVVYVLKRMEANPEKAWCFF 118 Query: 184 NWLS 195 NW+S Sbjct: 119 NWVS 122 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 82.0 bits (201), Expect = 5e-14 Identities = 36/62 (58%), Positives = 51/62 (82%) Frame = +1 Query: 13 LYFSSQPDSIAELVATNEWSEGLEEKLGKSHSTLSHETVLYVLKKLERNPLKALDFFNWL 192 L+FSS+P+SI ELV N+WS+ LE +L KS S L+HETV+YVLKKL+++P + +FFNW+ Sbjct: 59 LFFSSKPNSIVELVLENDWSDELESELEKSSSVLTHETVIYVLKKLDKDPQRTWNFFNWV 118 Query: 193 SE 198 +E Sbjct: 119 TE 120 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/65 (55%), Positives = 49/65 (75%) Frame = +1 Query: 4 HKNLYFSSQPDSIAELVATNEWSEGLEEKLGKSHSTLSHETVLYVLKKLERNPLKALDFF 183 HK LY SS+P S+ EL++ N+WS LE +L S L+HETV+YVLKKL+++P KA DFF Sbjct: 54 HKKLYSSSKPSSLVELLSVNDWSPELETQLENSSPLLTHETVIYVLKKLDKDPHKAWDFF 113 Query: 184 NWLSE 198 NW+ + Sbjct: 114 NWVCD 118 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/64 (56%), Positives = 49/64 (76%) Frame = +1 Query: 4 HKNLYFSSQPDSIAELVATNEWSEGLEEKLGKSHSTLSHETVLYVLKKLERNPLKALDFF 183 H L+FSS P S+ +LV+TN+WSE LE +L + TL+HETV+YVLK+L++ P KA +FF Sbjct: 49 HPVLFFSSNPQSLLQLVSTNDWSEMLETELETLNPTLTHETVVYVLKRLDKQPQKASEFF 108 Query: 184 NWLS 195 NW S Sbjct: 109 NWAS 112 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/66 (54%), Positives = 49/66 (74%), Gaps = 2/66 (3%) Frame = +1 Query: 1 THKNLYFSSQP--DSIAELVATNEWSEGLEEKLGKSHSTLSHETVLYVLKKLERNPLKAL 174 TH LYFS++P +SI EL+ TN+WS+ LE KL ++ HETVLYV+K+L++NP KA Sbjct: 52 THHKLYFSTKPKPNSIVELLLTNDWSQALELKLENRFPSMPHETVLYVIKRLDKNPEKAS 111 Query: 175 DFFNWL 192 FFNW+ Sbjct: 112 CFFNWV 117