BLASTX nr result
ID: Cimicifuga21_contig00033973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033973 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32925.3| unnamed protein product [Vitis vinifera] 74 1e-11 ref|XP_003543151.1| PREDICTED: interactor of constitutive active... 72 5e-11 ref|XP_003546766.1| PREDICTED: interactor of constitutive active... 71 8e-11 ref|XP_002271827.2| PREDICTED: interactor of constitutive active... 68 9e-10 emb|CAN73256.1| hypothetical protein VITISV_002134 [Vitis vinifera] 68 9e-10 >emb|CBI32925.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 74.3 bits (181), Expect = 1e-11 Identities = 37/53 (69%), Positives = 43/53 (81%) Frame = +3 Query: 159 MPRSRERISELPQRQSSKVPLHLRTSSSESHPLHQRPMVDRSPKLGDRRSPRG 317 MPR+R SE+PQRQS + L LRTSSS+S PLH RP+ DRSPK+GDRRSPRG Sbjct: 1 MPRTRG--SEMPQRQSPRGSLQLRTSSSDSDPLHHRPITDRSPKVGDRRSPRG 51 >ref|XP_003543151.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 1 [Glycine max] gi|356549542|ref|XP_003543152.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 2 [Glycine max] Length = 377 Score = 72.0 bits (175), Expect = 5e-11 Identities = 38/53 (71%), Positives = 41/53 (77%) Frame = +3 Query: 159 MPRSRERISELPQRQSSKVPLHLRTSSSESHPLHQRPMVDRSPKLGDRRSPRG 317 MPRSR SELPQRQS + RTSSS+S PLH RP+ DRSPKLGDRRSPRG Sbjct: 1 MPRSRG--SELPQRQSPRGAHQHRTSSSDSDPLHHRPIADRSPKLGDRRSPRG 51 >ref|XP_003546766.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 1 [Glycine max] gi|356556918|ref|XP_003546767.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 2 [Glycine max] Length = 380 Score = 71.2 bits (173), Expect = 8e-11 Identities = 38/53 (71%), Positives = 41/53 (77%) Frame = +3 Query: 159 MPRSRERISELPQRQSSKVPLHLRTSSSESHPLHQRPMVDRSPKLGDRRSPRG 317 MPRSR SELPQRQS + P RTSSS+S PLH R + DRSPKLGDRRSPRG Sbjct: 1 MPRSRG--SELPQRQSPRGPHQHRTSSSDSDPLHHRLIADRSPKLGDRRSPRG 51 >ref|XP_002271827.2| PREDICTED: interactor of constitutive active ROPs 4-like [Vitis vinifera] Length = 346 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +3 Query: 189 LPQRQSSKVPLHLRTSSSESHPLHQRPMVDRSPKLGDRRSPRG 317 +PQRQS + L LRTSSS+S PLH RP+ DRSPK+GDRRSPRG Sbjct: 1 MPQRQSPRGSLQLRTSSSDSDPLHHRPITDRSPKVGDRRSPRG 43 >emb|CAN73256.1| hypothetical protein VITISV_002134 [Vitis vinifera] Length = 376 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +3 Query: 189 LPQRQSSKVPLHLRTSSSESHPLHQRPMVDRSPKLGDRRSPRG 317 +PQRQS + L LRTSSS+S PLH RP+ DRSPK+GDRRSPRG Sbjct: 1 MPQRQSPRGSLQLRTSSSDSDPLHHRPITDRSPKVGDRRSPRG 43