BLASTX nr result
ID: Cimicifuga21_contig00033778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033778 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328689.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002317922.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|XP_003524508.1| PREDICTED: uncharacterized protein LOC100808... 57 2e-06 ref|XP_002511997.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_003549815.1| PREDICTED: uncharacterized protein LOC100797... 55 5e-06 >ref|XP_002328689.1| predicted protein [Populus trichocarpa] gi|222838865|gb|EEE77216.1| predicted protein [Populus trichocarpa] Length = 248 Score = 60.1 bits (144), Expect = 2e-07 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = -2 Query: 157 VSSSKKKLSARAVSRFRSVFG--GKHRSSHSMCLGTRVVCTLFGYRHGHVNFAF 2 +S+ KKKL A AV+R RSV GK+RSS + LG+RVV TLFGYR GHV+FAF Sbjct: 50 MSTPKKKLPAVAVARLRSVVTALGKNRSSLPLGLGSRVVGTLFGYRRGHVHFAF 103 >ref|XP_002317922.1| predicted protein [Populus trichocarpa] gi|222858595|gb|EEE96142.1| predicted protein [Populus trichocarpa] Length = 249 Score = 59.3 bits (142), Expect = 3e-07 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 2/50 (4%) Frame = -2 Query: 145 KKKLSARAVSRFRSVFG--GKHRSSHSMCLGTRVVCTLFGYRHGHVNFAF 2 KK+L A AV+R RSV GK+RSS M LG+RVV TLFGYR GHV+FAF Sbjct: 55 KKRLPAVAVARLRSVLAALGKNRSSLPMGLGSRVVGTLFGYRRGHVHFAF 104 >ref|XP_003524508.1| PREDICTED: uncharacterized protein LOC100808788 [Glycine max] Length = 272 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/53 (56%), Positives = 38/53 (71%), Gaps = 3/53 (5%) Frame = -2 Query: 151 SSKKKLSARAVSRFRSV---FGGKHRSSHSMCLGTRVVCTLFGYRHGHVNFAF 2 ++K+K+ A A+SR RSV F HRS+ LG+RVV TLFGYR GHV+FAF Sbjct: 71 ATKRKIQAVAISRLRSVLTVFSKNHRSNLPFGLGSRVVGTLFGYRRGHVHFAF 123 >ref|XP_002511997.1| conserved hypothetical protein [Ricinus communis] gi|223549177|gb|EEF50666.1| conserved hypothetical protein [Ricinus communis] Length = 256 Score = 57.0 bits (136), Expect = 2e-06 Identities = 33/50 (66%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 145 KKKLSARAVSRFRSVFG--GKHRSSHSMCLGTRVVCTLFGYRHGHVNFAF 2 KKKL A AV+R RSV GK+RSS LG RVV TLFGYR GHV+FAF Sbjct: 61 KKKLPAVAVARLRSVLAAFGKNRSSLPHGLGPRVVGTLFGYRRGHVHFAF 110 >ref|XP_003549815.1| PREDICTED: uncharacterized protein LOC100797914 [Glycine max] Length = 282 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/53 (56%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -2 Query: 154 SSSKKKLSARAVSRFRSVFG--GKHRSSHSMCLGTRVVCTLFGYRHGHVNFAF 2 +++K+KL A A+SR RSV K+RS+ LG+RVV TLFGYR GHV+FAF Sbjct: 87 AATKRKLQAVAISRLRSVLTVFSKNRSNLPFGLGSRVVGTLFGYRRGHVHFAF 139