BLASTX nr result
ID: Cimicifuga21_contig00033773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033773 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316664.1| f-box family protein [Populus trichocarpa] g... 79 7e-26 ref|XP_002305651.1| f-box family protein [Populus trichocarpa] g... 79 7e-26 ref|XP_002524686.1| TRANSPORT INHIBITOR RESPONSE 1 protein, puta... 78 4e-25 emb|CAN66468.1| hypothetical protein VITISV_016565 [Vitis vinifera] 78 2e-24 ref|XP_002271412.2| PREDICTED: protein TRANSPORT INHIBITOR RESPO... 78 4e-24 >ref|XP_002316664.1| f-box family protein [Populus trichocarpa] gi|222859729|gb|EEE97276.1| f-box family protein [Populus trichocarpa] Length = 579 Score = 79.0 bits (193), Expect(2) = 7e-26 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -1 Query: 150 PILLTNEHMDEAFGAIVKTCTKLQRLAASGLLDDLTF*YIRRYAKNLETL 1 P LTNE MDEAFGA+V+TCTKLQRL+ SGLL DLTF YI +YAKNLETL Sbjct: 417 PDYLTNEPMDEAFGAVVRTCTKLQRLSVSGLLTDLTFEYIGQYAKNLETL 466 Score = 63.2 bits (152), Expect(2) = 7e-26 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -2 Query: 269 LLETIHVFPEDPFDQDVLGGGVTKAGFAAVSRGCRNLHYVLYF 141 LLE + VFP DPFD++V+ G VT+AGF AVS GCR LHYVLYF Sbjct: 344 LLEELRVFPADPFDEEVIHG-VTEAGFLAVSYGCRRLHYVLYF 385 >ref|XP_002305651.1| f-box family protein [Populus trichocarpa] gi|222848615|gb|EEE86162.1| f-box family protein [Populus trichocarpa] Length = 579 Score = 79.0 bits (193), Expect(2) = 7e-26 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -1 Query: 150 PILLTNEHMDEAFGAIVKTCTKLQRLAASGLLDDLTF*YIRRYAKNLETL 1 P LTNE MDEAFGA+V+TCTKLQRL+ SGLL DLTF YI +YAKNLETL Sbjct: 417 PDYLTNEPMDEAFGAVVRTCTKLQRLSVSGLLTDLTFEYIGQYAKNLETL 466 Score = 63.2 bits (152), Expect(2) = 7e-26 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 269 LLETIHVFPEDPFDQDVLGGGVTKAGFAAVSRGCRNLHYVLYF 141 LLE + VFP DPFD++++ G VT+AGF AVS GCR LHYVLYF Sbjct: 344 LLEELRVFPADPFDEEIIHG-VTEAGFVAVSYGCRRLHYVLYF 385 >ref|XP_002524686.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] gi|223536047|gb|EEF37705.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] Length = 589 Score = 78.2 bits (191), Expect(2) = 4e-25 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -1 Query: 150 PILLTNEHMDEAFGAIVKTCTKLQRLAASGLLDDLTF*YIRRYAKNLETL 1 P TN+ MDEAFGA+VKTCTKLQRL+ SGLL DLTF YI RYAKNLETL Sbjct: 427 PDYTTNKPMDEAFGAVVKTCTKLQRLSVSGLLTDLTFEYIGRYAKNLETL 476 Score = 61.6 bits (148), Expect(2) = 4e-25 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 269 LLETIHVFPEDPFDQDVLGGGVTKAGFAAVSRGCRNLHYVLYF 141 LLE + VFP DPF+++++ G VT+AGF AVS GCR LHYVLYF Sbjct: 354 LLEELRVFPADPFEEEIIHG-VTEAGFVAVSYGCRRLHYVLYF 395 >emb|CAN66468.1| hypothetical protein VITISV_016565 [Vitis vinifera] Length = 620 Score = 77.8 bits (190), Expect(2) = 2e-24 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -1 Query: 150 PILLTNEHMDEAFGAIVKTCTKLQRLAASGLLDDLTF*YIRRYAKNLETL 1 P LT+E MDEAFGA+VK CTKLQRLA SGLL DLTF YI +YAKNLETL Sbjct: 461 PDYLTDEPMDEAFGAVVKNCTKLQRLAVSGLLTDLTFEYIGKYAKNLETL 510 Score = 59.3 bits (142), Expect(2) = 2e-24 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 5/100 (5%) Frame = -2 Query: 425 LFALLLLHTQP*NHLLQLTLQPVQRSHQ-----TLFHDCLAISKGSMLNISIVVVGVLLE 261 L+ +LL+ P L L + P S +LF+ + + ++ LLE Sbjct: 331 LWVILLISVVPVMLNLSLGIMPXSDSMDNSMCFSLFNXLVPTPISQHSSSPSRIICPLLE 390 Query: 260 TIHVFPEDPFDQDVLGGGVTKAGFAAVSRGCRNLHYVLYF 141 + VFP DP++QDV+ G VT+ GF AVS GC LHYVLYF Sbjct: 391 ELRVFPADPYEQDVVHG-VTEMGFVAVSYGCPRLHYVLYF 429 >ref|XP_002271412.2| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Vitis vinifera] Length = 583 Score = 77.8 bits (190), Expect(2) = 4e-24 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -1 Query: 150 PILLTNEHMDEAFGAIVKTCTKLQRLAASGLLDDLTF*YIRRYAKNLETL 1 P LT+E MDEAFGA+VK CTKLQRLA SGLL DLTF YI +YAKNLETL Sbjct: 424 PDYLTDEPMDEAFGAVVKNCTKLQRLAVSGLLTDLTFEYIGKYAKNLETL 473 Score = 58.5 bits (140), Expect(2) = 4e-24 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 269 LLETIHVFPEDPFDQDVLGGGVTKAGFAAVSRGCRNLHYVLYF 141 LLE + VFP DP++QDV+ G VT+ GF AVS GC LHYVLYF Sbjct: 351 LLEELRVFPADPYEQDVVHG-VTEMGFVAVSYGCPRLHYVLYF 392