BLASTX nr result
ID: Cimicifuga21_contig00033771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033771 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318266.1| potassium efflux antiporter [Populus trichoc... 59 5e-07 ref|XP_002510895.1| Glutathione-regulated potassium-efflux syste... 57 2e-06 dbj|BAB11240.1| potassium/proton antiporter-like protein [Arabid... 55 8e-06 ref|XP_002322428.1| potassium efflux antiporter [Populus trichoc... 55 8e-06 ref|NP_001119415.1| K(+) efflux antiporter 5 [Arabidopsis thalia... 55 8e-06 >ref|XP_002318266.1| potassium efflux antiporter [Populus trichocarpa] gi|222858939|gb|EEE96486.1| potassium efflux antiporter [Populus trichocarpa] Length = 580 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 284 LDAAPPDAGEGSIAKMFDRVLEKEFSENDQPEG 186 ++++ PD GEGSIAKMFDRVLEKEFS+NDQPEG Sbjct: 42 VNSSAPDNGEGSIAKMFDRVLEKEFSDNDQPEG 74 >ref|XP_002510895.1| Glutathione-regulated potassium-efflux system protein kefB, putative [Ricinus communis] gi|223550010|gb|EEF51497.1| Glutathione-regulated potassium-efflux system protein kefB, putative [Ricinus communis] Length = 565 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -2 Query: 284 LDAAPPDAGEGSIAKMFDRVLEKEFSENDQPEG 186 L+++ PD G+GSIA+MFDRVL+KEFSENDQPEG Sbjct: 42 LNSSAPDNGDGSIAQMFDRVLQKEFSENDQPEG 74 >dbj|BAB11240.1| potassium/proton antiporter-like protein [Arabidopsis thaliana] Length = 562 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 284 LDAAPPDAGEGSIAKMFDRVLEKEFSENDQPEG 186 +++ P GEGSIAKMFDRVLEKEFSEND PEG Sbjct: 36 VNSTAPGNGEGSIAKMFDRVLEKEFSENDSPEG 68 >ref|XP_002322428.1| potassium efflux antiporter [Populus trichocarpa] gi|222869424|gb|EEF06555.1| potassium efflux antiporter [Populus trichocarpa] Length = 525 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 284 LDAAPPDAGEGSIAKMFDRVLEKEFSENDQPEG 186 ++++ PD GEGSIAKM RVLEKEFSENDQPEG Sbjct: 17 VNSSAPDNGEGSIAKMIPRVLEKEFSENDQPEG 49 >ref|NP_001119415.1| K(+) efflux antiporter 5 [Arabidopsis thaliana] gi|332008735|gb|AED96118.1| K(+) efflux antiporter 5 [Arabidopsis thaliana] Length = 565 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 284 LDAAPPDAGEGSIAKMFDRVLEKEFSENDQPEG 186 +++ P GEGSIAKMFDRVLEKEFSEND PEG Sbjct: 36 VNSTAPGNGEGSIAKMFDRVLEKEFSENDSPEG 68